DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPF1 and tth

DIOPT Version :10

Sequence 1:XP_006723470.1 Gene:DPF1 / 8193 HGNCID:20225 Length:398 Species:Homo sapiens
Sequence 2:NP_572904.1 Gene:tth / 32318 FlyBaseID:FBgn0030502 Length:428 Species:Drosophila melanogaster


Alignment Length:266 Identity:73/266 - (27%)
Similarity:103/266 - (38%) Gaps:101/266 - (37%)


- Green bases have known domain annotations that are detailed below.


Human     5 IQNPLKSLGEDFYREAIEHCRSYNARLCAERSLRLPFLDSQTGVAQNNCYIWMEKTHRGPGLAPG 69
            |::.||.:.   |||.||:..::|.|||:||..||||||.|||||||:..::::|..|.||...|
  Fly    18 IESFLKDVS---YRETIEYSANFNTRLCSERRHRLPFLDPQTGVAQNHSQLFLDKRQRMPGFRQG 79

Human    70 QIYTYPARCWRKKRRLNILEDPRLRPCEYKIDCEAP---LKKE--------------------GG 111
            |||||||..|||.||..:.:       .|....|.|   |:||                    |.
  Fly    80 QIYTYPAARWRKSRRQYLSK-------MYSRFPERPFQALRKEHEALVASGVNLGLSSLTSGVGS 137

Human   112 LP--------------------EGPVLEALLCAETGEK---KIELKEEETI----------MDCQ 143
            :|                    ..|.:...|.::|...   ...|:|..::          .|.|
  Fly   138 MPGSNSLASSSSLTLNMLTGGGAAPAVLGSLHSDTAHDFNGAFSLEESSSLGAAGGDTSDSKDSQ 202

Human   144 KQQLLEFPH-----------------DLEVEDLE-------------DDIPR-----RKNRAKGK 173
            :||..:..|                 |:::.|::             |..||     |:.|..||
  Fly   203 QQQHQQHQHQQQAVKEELLPKEWFYDDMDMNDVDSLEEPKSPADDEYDYDPRYGNKKRRKRRPGK 267

Human   174 AYGIGG 179
            ..|..|
  Fly   268 RGGDSG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPF1XP_006723470.1 DPF1-3_N 13..79 CDD:464074 36/65 (55%)
SFP1 <186..220 CDD:227516
PHD1_DPF1 270..327 CDD:277160
PHD2_d4 328..383 CDD:277005
tthNP_572904.1 DPF1-3_N 24..89 CDD:464074 36/67 (54%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.