powered by:
Protein Alignment AT2G46495 and ASR1
DIOPT Version :9
Sequence 1: | NP_850456.2 |
Gene: | AT2G46495 / 819259 |
AraportID: | AT2G46495 |
Length: | 372 |
Species: | Arabidopsis thaliana |
Sequence 2: | NP_015418.2 |
Gene: | ASR1 / 856208 |
SGDID: | S000006297 |
Length: | 288 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 45 |
Identity: | 20/45 - (44%) |
Similarity: | 25/45 - (55%) |
Gaps: | 2/45 - (4%) |
- Green bases have known domain annotations that are detailed below.
plant 320 CPICLSEYASKETVRCIPECDHCFHSECIDVWLK--IHGSCPLCR 362
|||||::....|...|:..|.|.||..||..|.| |:..||:||
Yeast 4 CPICLADDQEGEQFGCLNVCGHKFHLNCIREWHKYSINLKCPICR 48
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
50 |
1.000 |
Domainoid score |
I3034 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.