DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT2G46495 and rnf38

DIOPT Version :9

Sequence 1:NP_850456.2 Gene:AT2G46495 / 819259 AraportID:AT2G46495 Length:372 Species:Arabidopsis thaliana
Sequence 2:XP_021331935.1 Gene:rnf38 / 566820 ZFINID:ZDB-GENE-030131-8693 Length:676 Species:Danio rerio


Alignment Length:146 Identity:40/146 - (27%)
Similarity:71/146 - (48%) Gaps:27/146 - (18%)


- Green bases have known domain annotations that are detailed below.


plant   237 PQVLKIILLSIIGPLTIFATCIAVGVCTS----------ERFASLIQRNVAIAALQPNEVIVTTG 291
            |.:|...|| :...|.:..|  |||...|          |.:.:|:.....:...:|.      |
Zfish   543 PSLLPYFLL-VRSVLPVQPT--AVGPAISLELDVDDGEVENYEALLNLAERLGEAKPR------G 598

plant   292 LDESIIESYKKTELGESRRLPGN--NDDIVCPICLSEYASKETVRCIPECDHCFHSECIDVWLKI 354
            |.::.||     :|...|..|.|  ::..:|.:|:.::.|::.:|.:| |:|.||::|:|.|||.
Zfish   599 LTKADIE-----QLPSYRFNPSNHQSEQTLCVVCMCDFESRQLLRVLP-CNHEFHAKCVDKWLKA 657

plant   355 HGSCPLCRNSPSPARQ 370
            :.:||:||...|..::
Zfish   658 NRTCPICRADASEVQR 673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT2G46495NP_850456.2 GUB_WAK_bind 28..93 CDD:404778
COG5219 <200..364 CDD:227544 39/138 (28%)
RING-H2_EL5_like 319..362 CDD:319375 16/42 (38%)
rnf38XP_021331935.1 RING-H2_RNF38_like 621..665 CDD:319386 16/44 (36%)
RING-H2 finger (C3H2C3-type) 624..664 CDD:319386 16/40 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 65 1.000 Domainoid score I4358
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.