DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment AT2G46495 and gol

DIOPT Version :9

Sequence 1:	NP_850456.2	Gene:	AT2G46495 / 819259	AraportID:	AT2G46495	Length:	372	Species:	Arabidopsis thaliana
Sequence 2:	NP_001163300.1	Gene:	gol / 38006	FlyBaseID:	FBgn0004919	Length:	601	Species:	Drosophila melanogaster

Alignment Length:	47	Identity:	21/47 - (44%)
Similarity:	28/47 - (59%)	Gaps:	1/47 - (2%)

- Green bases have known domain annotations that are detailed below.

plant   316 DDIVCPICLSEYASKETVRCIPECDHCFHSECIDVWLKIHGSCPLCR 362
            |...|.||:..|...:|:|.:| |.|.||..|||.||..|.:||:|:
  Fly   299 DSDCCAICIEAYKPTDTIRILP-CKHEFHKNCIDPWLIEHRTCPMCK 344

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
AT2G46495	NP_850456.2	GUB_WAK_bind	28..93	CDD:404778
		COG5219	<200..364	CDD:227544	21/47 (45%)
		RING-H2_EL5_like	319..362	CDD:319375	19/42 (45%)
gol	NP_001163300.1	PA_GRAIL_like	73..217	CDD:239037
		UPF0233	226..>258	CDD:299753
		zf-RING_2	301..344	CDD:290367	19/43 (44%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.910