powered by:
Protein Alignment AT2G46495 and gol
DIOPT Version :9
Sequence 1: | NP_850456.2 |
Gene: | AT2G46495 / 819259 |
AraportID: | AT2G46495 |
Length: | 372 |
Species: | Arabidopsis thaliana |
Sequence 2: | NP_001163300.1 |
Gene: | gol / 38006 |
FlyBaseID: | FBgn0004919 |
Length: | 601 |
Species: | Drosophila melanogaster |
Alignment Length: | 47 |
Identity: | 21/47 - (44%) |
Similarity: | 28/47 - (59%) |
Gaps: | 1/47 - (2%) |
- Green bases have known domain annotations that are detailed below.
plant 316 DDIVCPICLSEYASKETVRCIPECDHCFHSECIDVWLKIHGSCPLCR 362
|...|.||:..|...:|:|.:| |.|.||..|||.||..|.:||:|:
Fly 299 DSDCCAICIEAYKPTDTIRILP-CKHEFHKNCIDPWLIEHRTCPMCK 344
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.