powered by:
Protein Alignment AT2G46495 and rfp2
DIOPT Version :9
Sequence 1: | NP_850456.2 |
Gene: | AT2G46495 / 819259 |
AraportID: | AT2G46495 |
Length: | 372 |
Species: | Arabidopsis thaliana |
Sequence 2: | NP_593439.1 |
Gene: | rfp2 / 2543192 |
PomBaseID: | SPAC343.18 |
Length: | 205 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 54 |
Identity: | 19/54 - (35%) |
Similarity: | 22/54 - (40%) |
Gaps: | 5/54 - (9%) |
- Green bases have known domain annotations that are detailed below.
plant 312 PGNNDDIVCPICLSEYASKETVRCI-PECDHCFHSECIDVWLKIHGSCPL--CR 362
|.|| |.|..|.:|..|.|..... .:|.|.|.|.|.....|....||: ||
pombe 141 PHNN--IACAKCGNELVSDEKKSIFAAKCGHLFCSTCAKELRKKTVPCPVQHCR 192
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.