DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment AT2G46495 and dsc1

DIOPT Version :9

Sequence 1:	NP_850456.2	Gene:	AT2G46495 / 819259	AraportID:	AT2G46495	Length:	372	Species:	Arabidopsis thaliana
Sequence 2:	NP_595266.2	Gene:	dsc1 / 2541251	PomBaseID:	SPBC947.10	Length:	695	Species:	Schizosaccharomyces pombe

Alignment Length:	60	Identity:	18/60 - (30%)
Similarity:	26/60 - (43%)	Gaps:	13/60 - (21%)

- Green bases have known domain annotations that are detailed below.

plant   316 DDIVCPICLSEYASKET----------VR---CIPECDHCFHSECIDVWLKIHGSCPLCR 362
            |..|||||:.......|          ||   .:..|.|.:|.:|:..|::....||:||
pombe   630 DANVCPICMQPIELVSTGSTLNPASMMVRRNYMLTPCHHLYHRQCLLQWMETRSICPVCR 689

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
AT2G46495	NP_850456.2	GUB_WAK_bind	28..93	CDD:404778
		COG5219	<200..364	CDD:227544	18/60 (30%)
		RING-H2_EL5_like	319..362	CDD:319375	15/55 (27%)
dsc1	NP_595266.2	zf-RING_2	632..689	CDD:290367	15/56 (27%)
dsc1	NP_595266.2	zf-rbx1	<633..689	CDD:289448	15/55 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910