DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT2G46495 and RNF38

DIOPT Version :9

Sequence 1:NP_850456.2 Gene:AT2G46495 / 819259 AraportID:AT2G46495 Length:372 Species:Arabidopsis thaliana
Sequence 2:NP_073618.3 Gene:RNF38 / 152006 HGNCID:18052 Length:515 Species:Homo sapiens


Alignment Length:137 Identity:37/137 - (27%)
Similarity:68/137 - (49%) Gaps:21/137 - (15%)


- Green bases have known domain annotations that are detailed below.


plant   237 PQVLKIILLSI-----IGPLTIFATCIAVGVCTSERFASLIQRNVAIAALQPNEVIVTTGLDESI 296
            |.:|..:|..:     :||...|...:..|  ..|.:.:|:.....:...:|.      ||.::.
Human   386 PSLLPYVLSMLPVPPAVGPTFSFELDVEDG--EVENYEALLNLAERLGEAKPR------GLTKAD 442

plant   297 IESYKKTELGESRRLPGN--NDDIVCPICLSEYASKETVRCIPECDHCFHSECIDVWLKIHGSCP 359
            ||     :|...|..|.|  ::..:|.:|:.::.|::.:|.:| |:|.||::|:|.|||.:.:||
Human   443 IE-----QLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLP-CNHEFHAKCVDKWLKANRTCP 501

plant   360 LCRNSPS 366
            :||...|
Human   502 ICRADAS 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT2G46495NP_850456.2 GUB_WAK_bind 28..93 CDD:404778
COG5219 <200..364 CDD:227544 36/133 (27%)
RING-H2_EL5_like 319..362 CDD:319375 16/42 (38%)
RNF38NP_073618.3 Bipartite nuclear localization signal 1 57..71
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..141
Bipartite nuclear localization signal 2 115..131
RING-H2_RNF38_like 460..504 CDD:319386 16/44 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 65 1.000 Domainoid score I4385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.