DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MPK6 and rl

DIOPT Version :9

Sequence 1:NP_181907.1 Gene:MPK6 / 818982 AraportID:AT2G43790 Length:395 Species:Arabidopsis thaliana
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:344 Identity:180/344 - (52%)
Similarity:239/344 - (69%) Gaps:8/344 - (2%)


- Green bases have known domain annotations that are detailed below.


plant    51 IFGNIFEVTAKYKPPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLR 115
            |.|.||||..:| ..:..||:||||:|.||.::.||:.|||||| :.|:::...:||||||.:|.
  Fly    27 IRGQIFEVGPRY-IKLAYIGEGAYGMVVSADDTLTNQRVAIKKI-SPFEHQTYCQRTLREITILT 89

plant   116 HMDHENIVAIRDIIPPPLRNAFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYI 180
            ...||||:.||||:.....:...||||...||:|||:::::: |.||.:|..|||||||||||||
  Fly    90 RFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLKT-QRLSNDHICYFLYQILRGLKYI 153

plant   181 HSANVLHRDLKPSNLLLNANCDLKICDFGLARVTS-ESD---FMTEYVVTRWYRAPELLLNSSDY 241
            ||||||||||||||||||..||||||||||||:.. |.|   |:||||.||||||||::|||..|
  Fly   154 HSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGY 218

plant   242 TAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPSEEELE-FLNENAKRYIRQLPPY 305
            |.:||:||||||..|::..:|:|||:.::.||..::.::|:||.::|| .:||.|:.|:..||..
  Fly   219 TKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFK 283

plant   306 PRQSITDKFPTVHPLAIDLIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTIPFNFDFEN 370
            |.......||....||:||:.|||||:|.:||.|.:|||||||...:|..|||...:||..:.||
  Fly   284 PNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMEN 348

plant   371 HALSEEQMKELIYREALAF 389
            ..:|.:.:|.||:.|.|.|
  Fly   349 DDISRDALKSLIFEETLKF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MPK6NP_181907.1 STKc_TEY_MAPK 56..391 CDD:143363 177/339 (52%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 175/336 (52%)
S_TKc 38..326 CDD:214567 157/290 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37670
Inparanoid 1 1.050 349 1.000 Inparanoid score I618
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 1 1.000 - - otm2432
orthoMCL 1 0.900 - - OOG6_100339
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X259
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.