DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP and Rb97D

DIOPT Version :10

Sequence 1:NP_112487.1 Gene:SLIRP / 81892 HGNCID:20495 Length:109 Species:Homo sapiens
Sequence 2:NP_524520.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster


Alignment Length:57 Identity:22/57 - (38%)
Similarity:32/57 - (56%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    35 LKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQV 91
            |:|:|.|||:|....|..||.||..||..:|:|...:.:..|:.::.|.|..|.|.|
  Fly   139 LREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRPNP_112487.1 RRM_SLIRP 20..92 CDD:409688 22/57 (39%)
Rb97DNP_524520.1 RRM2_hnRNPA_like 124..196 CDD:409766 22/57 (39%)
RRM_SF 33..110 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.