DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP and pab2

DIOPT Version :9

Sequence 1:NP_112487.1 Gene:SLIRP / 81892 HGNCID:20495 Length:109 Species:Homo sapiens
Sequence 2:NP_595794.1 Gene:pab2 / 2539733 PomBaseID:SPBC16E9.12c Length:166 Species:Schizosaccharomyces pombe


Alignment Length:115 Identity:32/115 - (27%)
Similarity:52/115 - (45%) Gaps:13/115 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAASAARGAA----------ALR---RSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPF 52
            |.|.||:..|          |||   .||:....:|..:.::....:|:.|||..|.|.|..:..
pombe    24 MEAEAAKLRAMQEQLDNETEALRNDKESIDAQSVYVGNVDYSVTPEELQSHFASCGSVNRVTILC 88

Human    53 DKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQTS 102
            ||.||..:|..:::||....:.|||.....::....::|..:|..:|..|
pombe    89 DKFTGHPKGFAYIEFSEPSLVPNALLLNGSMLHERPLKVTPKRTNVPGMS 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRPNP_112487.1 RRM_SLIRP 20..92 CDD:409688 18/71 (25%)
pab2NP_595794.1 RRM 1..>138 CDD:223796 31/113 (27%)
bZIP <8..47 CDD:304365 7/22 (32%)
RRM_II_PABPs 56..128 CDD:240752 18/71 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.