DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLIRP and slirp

DIOPT Version :9

Sequence 1:NP_112487.1 Gene:SLIRP / 81892 HGNCID:20495 Length:109 Species:Homo sapiens
Sequence 2:XP_002938905.4 Gene:slirp / 100489427 XenbaseID:XB-GENE-22069127 Length:99 Species:Xenopus tropicalis


Alignment Length:87 Identity:48/87 - (55%)
Similarity:67/87 - (77%) Gaps:3/87 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     9 AAALRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGL 73
            ||..::|..   .||.|:|||.||.:|||:|:|:|.|::|:||||||||||||..||.|:|||||
 Frog     2 AAPAKKSFE---VFVSRVPWTVASRELKEYFSQYGVVKKCLLPFDKETGFHRGFCWVGFASEEGL 63

Human    74 RNALQQENHIIDGVKVQVHTRR 95
            :||||::.|:::|.|:||...:
 Frog    64 QNALQKDAHLLEGSKLQVQQNK 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLIRPNP_112487.1 RRM_SLIRP 20..92 CDD:409688 44/71 (62%)
slirpXP_002938905.4 RRM_SLIRP 10..82 CDD:409688 44/74 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I30351
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12825
Inparanoid 1 1.050 108 1.000 Inparanoid score I13063
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG49105
OrthoDB 1 1.010 - - D1587548at2759
OrthoFinder 1 1.000 - - FOG0005633
OrthoInspector 1 1.000 - - oto153014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X8849
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.