DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MPK20 and rl

DIOPT Version :9

Sequence 1:NP_565989.1 Gene:MPK20 / 818888 AraportID:AT2G42880 Length:606 Species:Arabidopsis thaliana
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:332 Identity:159/332 - (47%)
Similarity:226/332 - (68%) Gaps:11/332 - (3%)


- Green bases have known domain annotations that are detailed below.


plant    31 IGKGSYGVVCSAIDTLTGEKVAIKKIHDIFEHISDAARILREIKLLRLLRHPDIVEIKHIMLPPS 95
            ||:|:||:|.||.||||.::||||||.. |||.:...|.||||.:|...:|.:|::|:.|:...|
  Fly    44 IGEGAYGMVVSADDTLTNQRVAIKKISP-FEHQTYCQRTLREITILTRFKHENIIDIRDILRVDS 107

plant    96 RREFKDIYVVFELMESDLHQVIKANDDLTREHYQFFLYQLLRALKYIHTANVYHRDLKPKNILAN 160
            ..:.:|:|:|..|||:||::::| ...|:.:|..:||||:||.|||||:|||.||||||.|:|.|
  Fly   108 IDQMRDVYIVQCLMETDLYKLLK-TQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLN 171

plant   161 ANCKLKICDFGLARVAFNDTPTTIFWTDYVATRWYRAPELCGSFYSK-YTPAIDIWSIGCIFAEV 224
            ..|.||||||||||:|..:...|.|.|:|||||||||||:  ...|| ||.:|||||:|||.||:
  Fly   172 KTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEI--MLNSKGYTKSIDIWSVGCILAEM 234

plant   225 LMGKPLFPGKNVVHQLDLMTDLLGTPSLDTISRVRNEKARRYLTSMRKKPPIPFAQKFPNADPLS 289
            |..:|:||||:.:.||:.:..:||:||.|.:..:.|||||.||.|:..||.:|:|:.|||||.|:
  Fly   235 LSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFPNADALA 299

plant   290 LKLLERLLAFDPKDRPTAEEALADPYFKGLAKVEREPSCQPITKMEF--EFERRKVTKEDIRELI 352
            |.||.::|.|:|..|...|||||.||.:..    .:|..:|:.::.|  ..|...::::.::.||
  Fly   300 LDLLGKMLTFNPHKRIPVEEALAHPYLEQY----YDPGDEPVAEVPFRINMENDDISRDALKSLI 360

plant   353 SREILEY 359
            ..|.|::
  Fly   361 FEETLKF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MPK20NP_565989.1 STKc_TDY_MAPK 24..361 CDD:143364 159/332 (48%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 158/329 (48%)
S_TKc 38..326 CDD:214567 150/285 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.