DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZNF239 and CG4854

DIOPT Version :9

Sequence 1:XP_011538534.1 Gene:ZNF239 / 8187 HGNCID:13031 Length:602 Species:Homo sapiens
Sequence 2:NP_650860.1 Gene:CG4854 / 42391 FlyBaseID:FBgn0038766 Length:319 Species:Drosophila melanogaster


Alignment Length:325 Identity:85/325 - (26%)
Similarity:146/325 - (44%) Gaps:54/325 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   214 SQIDTQDSSVKFCKNEPQDH---------------------------------------QESRRL 239
            :.:|::|...:.|..:|:|.                                       :.:.:|
  Fly     3 TNVDSRDLKCRICLVQPKDESLMPTEPDFPDKIKRCTGVELSESPDWPNRICTSCALLLRAALKL 67

Human   240 FVMEESTERKVIKGESCSENLQVKLVSDGQEL-----ASPLLNGEATCQNGQLK-ESLDPIDCNC 298
            ..:.:.|| |.:|.:...| :.:::|.|.||.     :..|...|||..:.:|: |.||..|...
  Fly    68 RSLCQQTE-KDLKEQKLQE-INIEIVHDEQETKKKTESRDLSKNEATGSDSELEYEYLDSYDVTL 130

Human   299 KDIHGWKSQVVSCSQQRAHTEEKPCDHNNCGKILNTSPDGHPYEKIHTAE-KQYECSQCGKNFSQ 362
            :     .|:.|:||.....:.| |........:.:.||....:|...:.: ..:.|:.|...:|:
  Fly   131 E-----SSEDVACSADELVSIE-PAISAPEESVYSLSPKPVTFEDEDSGQAASFTCNICNNVYSE 189

Human   363 SSELLLHQRDHTEEKPYKCEQCGKGFTRSSSLLIHQAVHTDEKPYKCDKCGKGFTRSSSLLIHHA 427
            ..:|..|.:.|:.:||::||.|.|.|.::..|..|...||..:|||||.|...|...|:.:.|..
  Fly   190 RVKLTNHMKVHSAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCDSRFADPSTRIKHQR 254

Human   428 VHTGEKPYKCDKCGKGFSQSSKLHIHQRVHTGEKPYECEECGMSFSQRSNLHIHQRVHTGERPYK 492
            :||.|:||||:.|.:.|..|:.|.:|.:.||||:|:.|:.|..||||..:.:.|::.|...:..|
  Fly   255 IHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLHHKNSHEKSHKRTKEVK 319

Human   493  492
              Fly   320  319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZNF239XP_011538534.1 C2H2 Zn finger 326..345 CDD:275368 3/18 (17%)
COG5048 <337..537 CDD:227381 53/157 (34%)
C2H2 Zn finger 353..373 CDD:275368 5/19 (26%)
zf-H2C2_2 365..390 CDD:290200 10/24 (42%)
C2H2 Zn finger 381..401 CDD:275368 7/19 (37%)
zf-H2C2_2 393..418 CDD:290200 11/24 (46%)
C2H2 Zn finger 409..429 CDD:275368 6/19 (32%)
zf-H2C2_2 421..446 CDD:290200 10/24 (42%)
C2H2 Zn finger 437..457 CDD:275368 6/19 (32%)
zf-H2C2_2 453..474 CDD:290200 10/20 (50%)
C2H2 Zn finger 465..485 CDD:275368 7/19 (37%)
zf-H2C2_2 481..502 CDD:290200 3/12 (25%)
C2H2 Zn finger 493..513 CDD:275368 85/325 (26%)
zf-C2H2 519..541 CDD:278523
C2H2 Zn finger 521..541 CDD:275368
zf-H2C2_2 533..558 CDD:290200
COG5048 545..>602 CDD:227381
C2H2 Zn finger 549..569 CDD:275368
zf-H2C2_2 562..586 CDD:290200
C2H2 Zn finger 577..597 CDD:275368
CG4854NP_650860.1 zf-AD 12..>57 CDD:285071 3/44 (7%)
C2H2 Zn finger 180..200 CDD:275368 5/19 (26%)
zf-H2C2_2 193..217 CDD:290200 10/23 (43%)
COG5048 201..>258 CDD:227381 21/56 (38%)
C2H2 Zn finger 208..228 CDD:275368 7/19 (37%)
zf-H2C2_2 221..244 CDD:290200 10/22 (45%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
zf-H2C2_2 251..273 CDD:290200 10/21 (48%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-H2C2_2 277..301 CDD:290200 11/23 (48%)
C2H2 Zn finger 292..312 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.