DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NETO2 and Cubn

DIOPT Version :9

Sequence 1:NP_060562.3 Gene:NETO2 / 81831 HGNCID:14644 Length:525 Species:Homo sapiens
Sequence 2:NP_727348.2 Gene:Cubn / 326235 FlyBaseID:FBgn0052702 Length:3750 Species:Drosophila melanogaster


Alignment Length:550 Identity:126/550 - (22%)
Similarity:188/550 - (34%) Gaps:186/550 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    43 TQCGIWVRTSNGGHFASPNYPDSYPPNKECIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEV 107
            |.||. :..:..|.|.||.||.|||||.||:::|||:....:.||. |...:|.|..|..|:|||
  Fly  1790 TSCGS-IYNALSGKFTSPYYPASYPPNIECLWLLEASMGNSLSLTL-ESMDLEKSESCNRDYLEV 1852

Human   108 RDGPFGFSPLIDRYCGVKSPPLIRSTGRFMWIKFSSDEELEGLGFRAKYSF------------IP 160
            |:.... ..||..|||.:.|.:|.|.|. :|:||.||::..|.||.|.|::            |.
  Fly  1853 REESES-GQLIGVYCGNEVPGVIHSRGA-IWMKFKSDDDNVGEGFMASYNYEHHNELNGTEGTIE 1915

Human   161 DPDFTYLGGILNPIP-------DCQF---------------ELSGADG----------------I 187
            .|.|.  ....:|:|       |.::               .|:..||                |
  Fly  1916 SPHFP--SKFQDPVPYSWRITVDKEYVVAISLLYLRDLDQPHLNFYDGYSDIGARIEVTDPDETI 1978

Human   188 VRSSQV--------------------------EQEEKTK------------------PG------ 202
            :.|:.|                          ..||:|:                  ||      
  Fly  1979 ISSTNVVYFTSNRGPFKLNWNRLSKEALRSNRTAEERTRQCGNQLITIDRSVIGFHSPGYPNGYE 2043

Human   203 QAVDCIWT-IKATPKAKIYLRFLDYQME-HSNECKRNFVAVYDGS-----SSIENLKAKFCSTVA 260
            |.::|.|| :.:.|.....|......:| .|.:|..::|.::.||     |.:..|    ||   
  Fly  2044 QDLNCFWTLVPSNPAMHAVLTLSQIDLEIFSEDCIADYVKIFSGSDLQNWSELRTL----CS--- 2101

Human   261 NDVMLKTGIGVIRMWADEGSRLSRFR-MLFTSFVEPPCTSSTFFCHSNMCINNSLVCNGVQNCAY 324
                |.|         :...|:...| .|...||..|..:.|.|             ||:...| 
  Fly  2102 ----LPT---------ESSDRVFHGRPYLRVEFVTDPSVNKTGF-------------NGIVRTA- 2139

Human   325 PWDENHCKEKKKAGVFEQITKTHGTIIGITSGIVLVLLIISILVQVKQPRKKVMACKTAFNKTGF 389
                  |                |:.|..:.|:|.:..|:.:|     ||.......|...:.|.
  Fly  2140 ------C----------------GSEITASKGLVNITEILKVL-----PRPNHDCVWTIKVRQGR 2177

Human   390 QEVFDPPHYELFSLRDKEISADLADLSEELDNYQKMRRSSTASRCIHDHHCGSQASSVKQSRTNL 454
            :...|.|.::|        ..::|..|.:..||..:|..:.........  |.....|.....|.
  Fly  2178 RIKIDFPDFQL--------QNNMASGSSDCRNYLLLRNGNDEDSPFLGR--GKYCEDVVHEVLNT 2232

Human   455 SSMELPFRNDFAQPQPMKTFNSTFKKSSYT 484
            ||.:...:..||.| |....:..|::..||
  Fly  2233 SSNKAYIKFHFASP-PRFLVSFRFEELRYT 2261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NETO2NP_060562.3 CUB <205..291 CDD:238001 20/93 (22%)
LDLa 297..331 CDD:238060 5/33 (15%)
CUB 45..158 CDD:238001 48/112 (43%)
CubnNP_727348.2 EGF_CA 156..190 CDD:238011
EGF_CA 192..233 CDD:238011
EGF_CA 282..322 CDD:214542
EGF_3 328..366 CDD:289699
EGF 430..457 CDD:278437
EGF_CA 469..503 CDD:238011
CUB 509..622 CDD:238001
CUB 627..737 CDD:238001
CUB 744..849 CDD:294042
CUB 853..970 CDD:238001
CUB 978..1094 CDD:238001
CUB 1100..1211 CDD:238001
CUB 1216..1330 CDD:238001
CUB 1446..1549 CDD:238001
CUB 1554..1667 CDD:238001
CUB 1792..1899 CDD:238001 47/110 (43%)
CUB 1910..1998 CDD:294042 12/89 (13%)
CUB 2019..2133 CDD:238001 28/146 (19%)
CUB 2140..2242 CDD:238001 24/132 (18%)
CUB 2263..2379 CDD:238001
CUB 2385..2511 CDD:238001
CUB 2516..2630 CDD:238001
CUB <2833..2892 CDD:294042
CUB 2898..3008 CDD:238001
CUB 3011..3127 CDD:238001
CUB 3130..3241 CDD:238001
CUB 3254..3363 CDD:238001
CUB 3379..3508 CDD:238001
CUB 3531..3601 CDD:294042
CUB 3623..3733 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.