powered by:
Protein Alignment AT2G35420 and ASR1
DIOPT Version :9
Sequence 1: | NP_181085.2 |
Gene: | AT2G35420 / 818108 |
AraportID: | AT2G35420 |
Length: | 254 |
Species: | Arabidopsis thaliana |
Sequence 2: | NP_015418.2 |
Gene: | ASR1 / 856208 |
SGDID: | S000006297 |
Length: | 288 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 58 |
Identity: | 21/58 - (36%) |
Similarity: | 32/58 - (55%) |
Gaps: | 2/58 - (3%) |
- Green bases have known domain annotations that are detailed below.
plant 102 ECAICLSEFSDEDTVRLITVCRHPFHSNCIDLW--FELHKTCPVCRCELDPGMIGSGR 157
||.|||::..:.:....:.||.|.||.|||..| :.::..||:||.|.....:|.|:
Yeast 3 ECPICLADDQEGEQFGCLNVCGHKFHLNCIREWHKYSINLKCPICRVESTHLEVGEGQ 60
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
AT2G35420 | NP_181085.2 |
zf-RING_2 |
102..145 |
CDD:290367 |
16/44 (36%) |
ASR1 | NP_015418.2 |
RING-H2 |
4..48 |
CDD:319362 |
15/43 (35%) |
PHD |
121..167 |
CDD:214584 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
50 |
1.000 |
Domainoid score |
I3034 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.