DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT2G35420 and rnf44

DIOPT Version :9

Sequence 1:NP_181085.2 Gene:AT2G35420 / 818108 AraportID:AT2G35420 Length:254 Species:Arabidopsis thaliana
Sequence 2:NP_001070092.1 Gene:rnf44 / 767686 ZFINID:ZDB-GENE-060929-604 Length:448 Species:Danio rerio


Alignment Length:141 Identity:32/141 - (22%)
Similarity:61/141 - (43%) Gaps:34/141 - (24%)


- Green bases have known domain annotations that are detailed below.


plant    10 IPATAVFPSVSMPVTVVLTGVLLFVIFAGFFSLFLWQFLLNRLFTTWNLQRTPYGDLIHVAT--- 71
            :|.|||.|::|:.:.|.                              :::...|..|:::|.   
Zfish   330 VPPTAVGPAISLDLDVD------------------------------DVEMENYEALLNLAERLG 364

plant    72 PPENTGLDPFIIRSFPVFHYSSATKKNHGTECAICLSEFSDEDTVRLITVCRHPFHSNCIDLWFE 136
            ..:..||....|...|.:.::....::..|.|.:|.|:|.....:|::. |.|.||:.|:|.|.:
Zfish   365 EAKPRGLTKADIEQLPSYRFNLENHQSEQTLCVVCFSDFESRQLLRVLP-CNHEFHAKCVDKWLK 428

plant   137 LHKTCPVCRCE 147
            .::|||:||.:
Zfish   429 TNRTCPICRAD 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT2G35420NP_181085.2 zf-RING_2 102..145 CDD:290367 15/42 (36%)
rnf44NP_001070092.1 zf-RING_2 396..437 CDD:290367 15/41 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X146
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.