DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT2G35420 and Rnf133

DIOPT Version :9

Sequence 1:NP_181085.2 Gene:AT2G35420 / 818108 AraportID:AT2G35420 Length:254 Species:Arabidopsis thaliana
Sequence 2:NP_001037743.1 Gene:Rnf133 / 681395 RGDID:1596695 Length:381 Species:Rattus norvegicus


Alignment Length:127 Identity:37/127 - (29%)
Similarity:54/127 - (42%) Gaps:30/127 - (23%)


- Green bases have known domain annotations that are detailed below.


plant   103 CAICLSEFSDEDTVRLITVCRHPFHSNCIDLWFELHKTCPVCRCELDPGM-------IGSGRLE- 159
            |.||...:...:.||::| |:|.||.||||.|...|.|||:|:|::...:       .||..|: 
  Rat   256 CVICFEAYKPNEIVRILT-CKHFFHKNCIDPWILAHGTCPMCKCDILKALGIQMDIEDGSDSLQV 319

plant   160 ----SFHNTVTITIQDINHDEENPPTAGSSKRLIEASAWRFSRSHSTGHFMVKTTDANVKSK 217
                ....|.:...:::|:  |.||...|||               ..|.....|..||.|:
  Rat   320 LMSNELPGTFSAMEEELNN--ELPPARTSSK---------------VTHVQEHPTSVNVGSQ 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT2G35420NP_181085.2 zf-RING_2 102..145 CDD:290367 19/41 (46%)
Rnf133NP_001037743.1 PA_GRAIL_like 43..177 CDD:239037
HRD1 <183..>368 CDD:227568 37/127 (29%)
RING-H2_RNF128_like 254..302 CDD:319716 21/46 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..381 10/40 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I4247
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.