powered by:
Protein Alignment AT2G35420 and CG7694
DIOPT Version :9
Sequence 1: | NP_181085.2 |
Gene: | AT2G35420 / 818108 |
AraportID: | AT2G35420 |
Length: | 254 |
Species: | Arabidopsis thaliana |
Sequence 2: | NP_001138076.1 |
Gene: | CG7694 / 42230 |
FlyBaseID: | FBgn0038627 |
Length: | 147 |
Species: | Drosophila melanogaster |
Alignment Length: | 67 |
Identity: | 24/67 - (35%) |
Similarity: | 35/67 - (52%) |
Gaps: | 2/67 - (2%) |
- Green bases have known domain annotations that are detailed below.
plant 83 IRSFPVFHYSSATKKNHGTECAICLSEFSDEDTVRLITVCRHPFHSNCIDLWFELHKTCPVCRCE 147
|...|| |....:.:....||::| .|.::|.....|..|:|.||..||.||.:...:||:||.|
Fly 51 ILELPV-HEIVKSDEGGDLECSVC-KEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLCRYE 113
plant 148 LD 149
|:
Fly 114 LE 115
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
2 | 1.870 |
|
Return to query results.
Submit another query.