powered by:
Protein Alignment AT2G35420 and Rnf215
DIOPT Version :9
Sequence 1: | NP_181085.2 |
Gene: | AT2G35420 / 818108 |
AraportID: | AT2G35420 |
Length: | 254 |
Species: | Arabidopsis thaliana |
Sequence 2: | XP_006251362.1 |
Gene: | Rnf215 / 305478 |
RGDID: | 1310738 |
Length: | 383 |
Species: | Rattus norvegicus |
Alignment Length: | 47 |
Identity: | 20/47 - (42%) |
Similarity: | 32/47 - (68%) |
Gaps: | 2/47 - (4%) |
- Green bases have known domain annotations that are detailed below.
plant 100 GTE-CAICLSEFSDEDTVRLITVCRHPFHSNCIDLWFELHKTCPVCR 145
|.| ||:||..|.::..:|::. |:|.||.:|:|.|..|.:|||:|:
Rat 323 GAETCAVCLDYFCNKQWLRVLP-CKHEFHRDCVDPWLMLQQTCPLCK 368
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
66 |
1.000 |
Domainoid score |
I4247 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.