DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT2G35420 and Rnf215

DIOPT Version :9

Sequence 1:NP_181085.2 Gene:AT2G35420 / 818108 AraportID:AT2G35420 Length:254 Species:Arabidopsis thaliana
Sequence 2:XP_006251362.1 Gene:Rnf215 / 305478 RGDID:1310738 Length:383 Species:Rattus norvegicus


Alignment Length:47 Identity:20/47 - (42%)
Similarity:32/47 - (68%) Gaps:2/47 - (4%)


- Green bases have known domain annotations that are detailed below.


plant   100 GTE-CAICLSEFSDEDTVRLITVCRHPFHSNCIDLWFELHKTCPVCR 145
            |.| ||:||..|.::..:|::. |:|.||.:|:|.|..|.:|||:|:
  Rat   323 GAETCAVCLDYFCNKQWLRVLP-CKHEFHRDCVDPWLMLQQTCPLCK 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT2G35420NP_181085.2 zf-RING_2 102..145 CDD:290367 18/43 (42%)
Rnf215XP_006251362.1 zf-RING_2 325..368 CDD:290367 18/43 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I4247
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.