DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT2G35420 and meu34

DIOPT Version :9

Sequence 1:NP_181085.2 Gene:AT2G35420 / 818108 AraportID:AT2G35420 Length:254 Species:Arabidopsis thaliana
Sequence 2:NP_593329.1 Gene:meu34 / 2543036 PomBaseID:SPAC3A12.03c Length:309 Species:Schizosaccharomyces pombe


Alignment Length:188 Identity:39/188 - (20%)
Similarity:66/188 - (35%) Gaps:63/188 - (33%)


- Green bases have known domain annotations that are detailed below.


plant    74 ENTGLDPFIIRSFPV----------FHYSSATKKNHGTE-------------------CAICLSE 109
            :..|..|.:|.::.|          ...|||....:.|:                   |.||.::
pombe   147 QGQGETPSVIITYDVRRPNLGSTSFVEMSSALSNIYNTDASDGDSSDDSCLLEDEEDFCIICYAD 211

plant   110 FSDEDTVRLITVCRHPFHSNCIDLWFELHK-TCPVCRCELDPGMIGSGRLESFHNTVTITIQDIN 173
            ::.:|.:|::. |.|.||:.|||.|....| :||:|.             |.::...      :.
pombe   212 YAFDDILRVLP-CEHVFHTQCIDTWMTTMKASCPLCN-------------EDYYKYF------LQ 256

plant   174 HDEENPPTAGSSKRLIEASAWRF------SRSHSTGHFMVKTTDANVKSKRRHYQTGS 225
            .|..:..|.       |.:||..      ||:||........:..:|::.|..|...|
pombe   257 MDAASSVTH-------ENAAWSIPLSPGDSRTHSAETDRSLLSAMSVRNSRMPYIVSS 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT2G35420NP_181085.2 zf-RING_2 102..145 CDD:290367 16/62 (26%)
meu34NP_593329.1 RING 205..249 CDD:238093 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1960
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.