DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT2G35420 and SPBP4H10.07

DIOPT Version :9

Sequence 1:NP_181085.2 Gene:AT2G35420 / 818108 AraportID:AT2G35420 Length:254 Species:Arabidopsis thaliana
Sequence 2:NP_596181.1 Gene:SPBP4H10.07 / 2541304 PomBaseID:SPBP4H10.07 Length:583 Species:Schizosaccharomyces pombe


Alignment Length:118 Identity:33/118 - (27%)
Similarity:48/118 - (40%) Gaps:24/118 - (20%)


- Green bases have known domain annotations that are detailed below.


plant    45 WQFLLNRLFTTWN--LQRTP--------YGD------LIHVATPPENTGLDPFIIRSFPVFHYSS 93
            |...:...|...|  :.|.|        |.|      :|.:..||..:..|  :.::..||.:|.
pombe   458 WAIYVREAFVPQNHPVLRAPSLFTDSPTYEDMLLLNSIIGIEKPPVASQKD--LEKAGGVFPFSG 520

plant    94 ATKKNHGTECAICLSEFSDEDTVRLITVCRHPFHSNCIDLWF-ELHKTCPVCR 145
            ..::     |.:|||.|...|..|.:..|.|.||..|||.|. ....:||:||
pombe   521 TDER-----CLVCLSNFELNDECRRLKQCNHFFHRECIDQWLTSSQNSCPLCR 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT2G35420NP_181085.2 zf-RING_2 102..145 CDD:290367 17/43 (40%)
SPBP4H10.07NP_596181.1 PHA03328 77..>156 CDD:223046
zf-rbx1 <522..568 CDD:289448 17/50 (34%)
RING 525..570 CDD:238093 19/44 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.