DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT2G35420 and hrd1

DIOPT Version :9

Sequence 1:NP_181085.2 Gene:AT2G35420 / 818108 AraportID:AT2G35420 Length:254 Species:Arabidopsis thaliana
Sequence 2:NP_596376.1 Gene:hrd1 / 2539900 PomBaseID:SPBC17D11.02c Length:677 Species:Schizosaccharomyces pombe


Alignment Length:232 Identity:48/232 - (20%)
Similarity:80/232 - (34%) Gaps:62/232 - (26%)


- Green bases have known domain annotations that are detailed below.


plant    16 FPSVSMPVTVVLTGVLLFVIFAGFFSLFL-----WQFL-----LNRLFTTWNLQRTPYGD----- 65
            ||.||:|:..:..      ::..|:|||.     .:|.     :|.::.|...::....|     
pombe   236 FPYVSVPIYSIRQ------MYTCFYSLFRRIREHARFRQATRDMNAMYPTATEEQLTNSDRTCTI 294

plant    66 ----LIHVATPPENTG-LDPFIIRSFPVFHYSSATKKNHGTECAICLSEFSDEDTVRLITVCRHP 125
                :.|...|||||. ::|                          |....|....||  .|.|.
pombe   295 CREEMFHPDHPPENTDEMEP--------------------------LPRGLDMTPKRL--PCGHI 331

plant   126 FHSNCIDLWFELHKTCPVCRCELDPGMIGSGRLESFHNTVTITIQDINHDEENPPTA-------- 182
            .|.:|:..|.|..:|||:||..:.........:.:..|.....|.....:.:|.||.        
pombe   332 LHFHCLRNWLERQQTCPICRRSVIGNQSSPTGIPASPNVRATQIATQVPNPQNTPTTTAVPGITN 396

plant   183 GSSKRLIEASAWRFSRSHSTGHFMVKTTDANVKSKRR 219
            .|::...:||.:....:.::..|...|.|.:....||
pombe   397 SSNQGDPQASTFNGVPNANSSGFAAHTQDLSSVIPRR 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT2G35420NP_181085.2 zf-RING_2 102..145 CDD:290367 13/42 (31%)
hrd1NP_596376.1 HRD1 1..514 CDD:227568 48/232 (21%)
zf-RING_2 291..351 CDD:290367 20/87 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.