DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT2G35420 and SPCC4G3.12c

DIOPT Version :9

Sequence 1:NP_181085.2 Gene:AT2G35420 / 818108 AraportID:AT2G35420 Length:254 Species:Arabidopsis thaliana
Sequence 2:NP_587826.1 Gene:SPCC4G3.12c / 2539364 PomBaseID:SPCC4G3.12c Length:821 Species:Schizosaccharomyces pombe


Alignment Length:134 Identity:36/134 - (26%)
Similarity:51/134 - (38%) Gaps:33/134 - (24%)


- Green bases have known domain annotations that are detailed below.


plant    29 GVLLFVIFAGFF----------SLFLWQFLLNRLFTTWNLQRTPYGDLIHVAT------PPENTG 77
            |..|..:|.|.|          |||              .....|.||:.:.|      .|..:.
pombe   692 GDWLIYVFGGLFPEHHPVLSTVSLF--------------SDNPMYEDLLALTTYLGPAKKPVASH 742

plant    78 LDPFIIRSFPVFHYSSATKKNHGTECAICLSEFSDEDTVRLITVCRHPFHSNCIDLWFEL-HKTC 141
            .|  :.||..:|.|......:....|.|||..:::.|..|.:..|:|.||..|||.|... :.:|
pombe   743 ED--VKRSGGLFAYFDDASLSSADSCLICLETYTNGDICRKLQACKHFFHQACIDQWLTTGNNSC 805

plant   142 PVCR 145
            |:||
pombe   806 PLCR 809

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT2G35420NP_181085.2 zf-RING_2 102..145 CDD:290367 16/43 (37%)
SPCC4G3.12cNP_587826.1 zf-RING_2 764..809 CDD:290367 16/44 (36%)
zf-rbx1 <764..809 CDD:289448 16/44 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.