DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT2G35420 and ZNRF2

DIOPT Version :9

Sequence 1:NP_181085.2 Gene:AT2G35420 / 818108 AraportID:AT2G35420 Length:254 Species:Arabidopsis thaliana
Sequence 2:NP_667339.1 Gene:ZNRF2 / 223082 HGNCID:22316 Length:242 Species:Homo sapiens


Alignment Length:139 Identity:35/139 - (25%)
Similarity:47/139 - (33%) Gaps:51/139 - (36%)


- Green bases have known domain annotations that are detailed below.


plant    53 FTTWNLQRTPYGDLIHVATPPENTG------------------------LDPFIIRSF------- 86
            |:..|....|||....|.:.||:.|                        |.|.:...|       
Human   101 FSIPNSSSGPYGSQDSVHSSPEDGGGGRDRPVGGSPGGPRLVIGSLPAHLSPHMFGGFKCPVCSK 165

plant    87 -----------------PVFHYSSATKKNHGTECAICLSEFSDEDTV-RLITVCRHPFHSNCIDL 133
                             |...|:.........||||||.|....||: ||..:|  .:|..|||.
Human   166 FVSSDEMDLHLVMCLTKPRITYNEDVLSKDAGECAICLEELQQGDTIARLPCLC--IYHKGCIDE 228

plant   134 WFELHKTCP 142
            |||::::||
Human   229 WFEVNRSCP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT2G35420NP_181085.2 zf-RING_2 102..145 CDD:290367 21/42 (50%)
ZNRF2NP_667339.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..141 9/39 (23%)
zf-RING_2 197..237 CDD:290367 19/41 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X146
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.