powered by:
Protein Alignment AT2G35420 and RNF38
DIOPT Version :9
Sequence 1: | NP_181085.2 |
Gene: | AT2G35420 / 818108 |
AraportID: | AT2G35420 |
Length: | 254 |
Species: | Arabidopsis thaliana |
Sequence 2: | NP_073618.3 |
Gene: | RNF38 / 152006 |
HGNCID: | 18052 |
Length: | 515 |
Species: | Homo sapiens |
Alignment Length: | 71 |
Identity: | 21/71 - (29%) |
Similarity: | 39/71 - (54%) |
Gaps: | 1/71 - (1%) |
- Green bases have known domain annotations that are detailed below.
plant 77 GLDPFIIRSFPVFHYSSATKKNHGTECAICLSEFSDEDTVRLITVCRHPFHSNCIDLWFELHKTC 141
||....|...|.:.::....::..|.|.:|:.:|.....:|::. |.|.||:.|:|.|.:.::||
Human 437 GLTKADIEQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLP-CNHEFHAKCVDKWLKANRTC 500
plant 142 PVCRCE 147
|:||.:
Human 501 PICRAD 506
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
1 |
1.000 |
- |
- |
|
X146 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.