DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT2G35420 and RNF38

DIOPT Version :9

Sequence 1:NP_181085.2 Gene:AT2G35420 / 818108 AraportID:AT2G35420 Length:254 Species:Arabidopsis thaliana
Sequence 2:NP_073618.3 Gene:RNF38 / 152006 HGNCID:18052 Length:515 Species:Homo sapiens


Alignment Length:71 Identity:21/71 - (29%)
Similarity:39/71 - (54%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


plant    77 GLDPFIIRSFPVFHYSSATKKNHGTECAICLSEFSDEDTVRLITVCRHPFHSNCIDLWFELHKTC 141
            ||....|...|.:.::....::..|.|.:|:.:|.....:|::. |.|.||:.|:|.|.:.::||
Human   437 GLTKADIEQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLP-CNHEFHAKCVDKWLKANRTC 500

plant   142 PVCRCE 147
            |:||.:
Human   501 PICRAD 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT2G35420NP_181085.2 zf-RING_2 102..145 CDD:290367 14/42 (33%)
RNF38NP_073618.3 Bipartite nuclear localization signal 1 57..71
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..141
Bipartite nuclear localization signal 2 115..131
RING-H2_RNF38_like 460..504 CDD:319386 15/44 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X146
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.