DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAMK2G and CaMKI

DIOPT Version :9

Sequence 1:XP_016872205.1 Gene:CAMK2G / 818 HGNCID:1463 Length:615 Species:Homo sapiens
Sequence 2:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster


Alignment Length:415 Identity:150/415 - (36%)
Similarity:213/415 - (51%) Gaps:58/415 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    12 DDYQLFEELGKGAFSVVRRCVKKTSTQE-YAAKIINTKKLSARDHQKLEREARICR--------- 66
            :.|.|...||.||||.||....|.|..| :|.|||:.|.|..:: :.||.|.|:.|         
  Fly    29 EKYNLHGLLGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKE-ESLENEIRVLRRFSANHFDG 92

Human    67 ------LLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVN 125
                  .|.|||||:|.::..::...|||.:||||||||:.||.:..|:|.||||.|.||||:|:
  Fly    93 KCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVD 157

Human   126 HIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLA-IEVQGEQQAWFGFAGTPGYLSPEVLRKD 189
            ::|:..:|||||||||||..|....:.:.::||||: :|..|....   ..|||||::||||.:.
  Fly   158 YMHEQGVVHRDLKPENLLYYSPDDDSKIMISDFGLSKMEDSGIMAT---ACGTPGYVAPEVLAQK 219

Human   190 PYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLT 254
            ||||.||:|:.|||.||||.|||||:||:...|:.||..|.::|.||.||.::..||:.|..::.
  Fly   220 PYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSPYWDEISESAKHFIKNLMC 284

Human   255 INPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKLKGAILTTMLVSRNFSVGRQ 319
            :...||.|..|||.|.|:.....                  :.|.:.|.:  :..:.:||:..|.
  Fly   285 VTVEKRYTCKQALGHAWISGNEA------------------SSRNIHGTV--SEQLKKNFAKSRW 329

Human   320 SSAPASPAASAAGLAGQAAKSLLNKKSDGGVKKRKSSSSVHLMPQSNNKNSLVSPAQEPAPLQTA 384
            ..     |..||.:..|..:..||..|:.......||          |::|....|...|.....
  Fly   330 KQ-----AYYAATVIRQMQRMALNSNSNANFDSSNSS----------NQDSTTPTAATGAWTSNV 379

Human   385 MEPQTTVVHNATDGIK--GSTESCN 407
            :..|.:|..:|.:..|  |||.:.:
  Fly   380 LSSQQSVQSHAQEMNKSGGSTNAAS 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAMK2GXP_016872205.1 None
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 124/275 (45%)
S_TKc 31..302 CDD:214567 124/274 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D330091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X46
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.