DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rps6ka1 and S6k

DIOPT Version :9

Sequence 1:XP_006239145.1 Gene:Rps6ka1 / 81771 RGDID:620675 Length:741 Species:Rattus norvegicus
Sequence 2:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster


Alignment Length:395 Identity:188/395 - (47%)
Similarity:250/395 - (63%) Gaps:28/395 - (7%)


- Green bases have known domain annotations that are detailed below.


  Rat    40 QDSDEGILK--------EISITHH---------------VKAGSEKADPSHFELLKVLGQGSFGK 81
            :|||:..::        |:.|..|               |..|..|..|..|||.||||:|.:||
  Fly    26 RDSDDDRIELDDVDLEPELCINLHQDTEGQETIQLCEENVNPGKIKLGPKDFELKKVLGKGGYGK 90

  Rat    82 VFLVRKVTRPDNGHLYAMKVLKKATL--KVRDRVRTKMERDILADVNHPFVVKLHYAFQTEGKLY 144
            ||.|||....|....:||||||||::  ..:|...|:.||:||..|.|||:|:|.|||||:||||
  Fly    91 VFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPFIVELVYAFQTDGKLY 155

  Rat   145 LILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKL 209
            |||::|.||:||..|.:|.:|.|:...|||:|:.|.|.|||.||||||||||||||||.:||:||
  Fly   156 LILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHVKL 220

  Rat   210 TDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHTHSADWWSYGVLMFEMLTGSLPFQGKDRK 274
            |||||.||.|......::||||:||||||::.|.||..:.||||.|.|||:||||..||..::||
  Fly   221 TDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMFDMLTGVPPFTAENRK 285

  Rat   275 ETMTLILKAKLGMPQFLSTEAQSLLRALFKRNPANRLGSGPDGAEEIKRHIFYSTIDWNKLYRRE 339
            :|:..||||||.:|.:|:.||:.|:|.|.||....||||||:.|..::.|.|:..::|:.:..|.
  Fly   286 KTIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFKHVNWDDVLARR 350

  Rat   340 IKPPFKPAVAQPDDTFYFDTEFTSRTPRDSP-GIPPSAGAHQLFRGFSFVATGLMEDDSKPRATQ 403
            ::||.||.:...||...|||.||.:.|.||| ....|..|:.:|:||::||..::||  ..||.:
  Fly   351 LEPPIKPLLRSEDDVSQFDTRFTRQIPVDSPDDTTLSESANLIFQGFTYVAPSILED--MHRANR 413

  Rat   404 APLHS 408
            .|..|
  Fly   414 MPARS 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rps6ka1XP_006239145.1 S_TKc 68..326 CDD:214567 147/259 (57%)
STKc_RSK_N 72..388 CDD:270734 167/318 (53%)
STKc_RSK1_C 422..712 CDD:271077
Pkinase 424..681 CDD:278497
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 168/320 (53%)
STKc_p70S6K 81..402 CDD:270736 168/320 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334260
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1132245at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.