DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FRA8 and sotv

DIOPT Version :9

Sequence 1:NP_850113.2 Gene:FRA8 / 817357 AraportID:AT2G28110 Length:448 Species:Arabidopsis thaliana
Sequence 2:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster


Alignment Length:390 Identity:85/390 - (21%)
Similarity:147/390 - (37%) Gaps:85/390 - (21%)


- Green bases have known domain annotations that are detailed below.


plant    85 NIKTDVFNNLKIYVYDLPSKFNKDWLANDRCTNHLFAAEVALHKAFLSLEGDVRTEDPYEADFFF 149
            ||.....:.||:|:|.|....::.   :|:....|.:....:.:|.  |:....|.:|.|| ..|
  Fly    99 NIYKCEHDRLKVYIYPLQEFVDEQ---SDKTATTLSSEYFQILEAV--LKSRYYTSNPNEA-CLF 157

plant   150 VPVYVSCNFSTINGFPAIGHARSLINDAIKLVSTQYPFWNRTSGSDH-VFTATHDFGSCFHTMED 213
            :|   |.:....|.|.     :.|...|:    ....||:|  |::| :|.........::|:.|
  Fly   158 LP---SLDLLNQNVFD-----KHLAGAAL----ASLDFWDR--GANHIIFNMLPGGAPSYNTVLD 208

plant   214 RAIADGVPIFLRNSIILQTFGVTFN----HPCQEVENVVIPPYISPESLHKT--QKNIPVTKERD 272
                    :...|:||   ||..|:    .|..:|...|..|.:..:..|.|  :|.:.|..:  
  Fly   209 --------VNTDNAII---FGGGFDSWSYRPGFDVAIPVWSPRLVRQHAHATAQRKFLLVVAQ-- 260

plant   273 IWVFFRGKMELHPKNISGRFYSKRVRTNIWRSYGGDRRFYL----------------QRQRFAGY 321
                         .||..||    |||....|.....:..|                |..:...|
  Fly   261 -------------LNILPRF----VRTLRELSLAHSEQLLLLGACENLDLTMRCPLSQHHKSLEY 308

plant   322 QSEIARSVFCLCPLGWAPWSPRLVESVALGCVPVIIADGIRLPFPSTVRWPDISLTVAERDVGKL 386
            ...::|..|||.........|.|||.::..|:|||..|...|||...:.|...|:.:.|.::..:
  Fly   309 PRLLSRGKFCLLGRSLRMGQPDLVEIMSQHCIPVIAVDNYVLPFEDVIDWSLASVRIRENELHSV 373

plant   387 GDILEHVAATNLSVIQRNLEDPSVRRALMFNVPSRE-GDATWQVLEALSKKL----NRSVRRSNS 446
            ...|:.:::..:..:|:.::       .:|:...:: ...|...||.|..::    .||.|:.|:
  Fly   374 MQKLKAISSVKIVEMQKQVQ-------WLFSKYFKDLKTVTLTALEVLESRIFPLRARSSRQWNT 431

plant   447  446
              Fly   432  431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FRA8NP_850113.2 Exostosin 94..391 CDD:281069 72/319 (23%)
sotvNP_725536.1 Exostosin 105..380 CDD:281069 73/324 (23%)
Glyco_transf_64 455..689 CDD:286358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.