DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP711A1 and Cyp6a16

DIOPT Version :9

Sequence 1:NP_565617.2 Gene:CYP711A1 / 817157 AraportID:AT2G26170 Length:522 Species:Arabidopsis thaliana
Sequence 2:NP_001285631.1 Gene:Cyp6a16 / 19836250 FlyBaseID:FBgn0031726 Length:500 Species:Drosophila melanogaster


Alignment Length:537 Identity:144/537 - (26%)
Similarity:240/537 - (44%) Gaps:93/537 - (17%)


- Green bases have known domain annotations that are detailed below.


plant    21 LIAFLTFAAVVIVIYL-YR-PSWSVCNVPGPTAMPLVGHL----------PLMAKYGPDVFSVLA 73
            |.:.|:|    ::.|| || ..|.:..:|......|.||.          .|...|  |.|...|
  Fly     8 LTSLLSF----LLGYLRYRFTYWELRGIPQLRPHFLFGHFFRLQSVHYSELLQETY--DAFRGSA 66

plant    74 KQYGP-IFRFQMGRQPLIIIAEAELCREVGIKKFKDLPNRSI--PSPISASPLHKKGLFFTRDKR 135
            |..|. :|     .:|:.::.:.:|.:.|.|:.|.:..:|..  ..|::|:      ||..:.:.
  Fly    67 KVAGTYVF-----LRPMAVVLDLDLVKAVLIRDFNNFVDRRSFHGDPLTAN------LFNLQGEE 120

plant   136 WSKMRNTILSLYQPSHLTSLIPTMHSFITSATHNLDSKPRDIVFS--------NLFLKLTTDIIG 192
            |..:|..:    .|:..:..:..|...:::....|.....::|.|        :|..:.|||:||
  Fly   121 WRNLRTKL----SPTFTSGKMKYMFGTVSTVAQQLGGTFDELVGSQGAVLELHDLMARYTTDVIG 181

plant   193 QAAFGVDFGLSGKKPIKDVEVTDFINQHVYSTTQ-------LKMDLSGSLSIILGLLIPILQEPF 250
            ..|||.:.. |.::|..:...   :.:.::..:.       .||....||: .|||.:.||....
  Fly   182 SCAFGTECS-SLREPQAEFRQ---VGRRIFRNSNRSIRWRIFKMTYLSSLA-KLGLPVRILHPDI 241

plant   251 RQVLKRIPGTMDWRVEKTNARLSGQLNEIVSKRAKEAETDSKDFLSLILKARESDPFAKNIFTSD 315
            .:...||                  :.|.|..|.:| .....||:.|:|..|..:. .|.: |.:
  Fly   242 TKFFNRI------------------VRETVELRERE-NIRRNDFMDLLLDLRRQEN-GKGL-TME 285

plant   316 YISAVTYEHLLAGSATTAFTLSSVLYLVSGHLDVEKRLLQEI-DGFGNRDLIPTAHDLQHKFPYL 379
            .::|..:...:||..|::..:|..|:.::.:.||:::|..|| |..|....:  .::...:.|||
  Fly   286 QMAAQAFVFFVAGFETSSSNMSYALFELAKNQDVQQKLRMEINDSIGKHGKL--TYEAMMEMPYL 348

plant   380 DQVIKEAMRFYMVSPLVARETAKEVEI----GG--YLLPKGTWVWLALGVLAKDPKNFPEPEKFK 438
            ||.|.|.:|.|.....:.|..:::.||    ||  .:|.|||.|.:.:..:..||:.:|||.:|:
  Fly   349 DQTITETLRKYPALSSLTRLASEDYEIPSPDGGDPVVLEKGTSVHIPVLAIHYDPEVYPEPHEFR 413

plant   439 PERFDPNGEEEKHRHPYAFIPFGIGPRACVGQRFALQEIKLTLLHLYRNYIFRHSLEMEIPLQLD 503
            ||||.|:...|  |||.||:.||.|||.|:|.||...::|:.|:.|.|.  ||.||....|.||.
  Fly   414 PERFAPDACRE--RHPTAFLGFGDGPRNCIGLRFGRMQVKVGLITLLRR--FRFSLPPGSPTQLK 474

plant   504 Y---GIILSFKNGVKLR 517
            .   .:||...:||:|:
  Fly   475 VTKRNLILLPSDGVRLQ 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP711A1NP_565617.2 cytochrome_P450 75..515 CDD:425388 124/467 (27%)
Cyp6a16NP_001285631.1 p450 32..492 CDD:278495 136/509 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1386
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1621
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X40
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.