DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jdp2 and kay

DIOPT Version :9

Sequence 1:XP_011242520.1 Gene:Jdp2 / 81703 MGIID:1932093 Length:286 Species:Mus musculus
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:258 Identity:65/258 - (25%)
Similarity:100/258 - (38%) Gaps:56/258 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse    40 GCAYITARRVLLPRALGSRGRGAPPDRNAAGTSAAGPGPAPQAEEREHRREEGAGGGGGEAPPGR 104
            |||.....:| ||.|:...|.|.|     .|.|:.   |..|..:.       :.|.|.|:....
  Fly   278 GCAGFAVPKV-LPNAIDVLGMGIP-----TGVSSL---PLQQTFDL-------SLGQGSESEDSN 326

Mouse   105 PATPPAMM--------------------PGQIPDPSVTAGSLPGLGPLTGLPSSALTTEELKYAD 149
            .:.....|                    .|.|...||..|.:.....:....||:..:       
  Fly   327 ASYNDTQMNEEQDTTDTSSAHTDSTSYQAGHIMAGSVNGGGVNNFSNVLAAVSSSRGS------- 384

Mouse   150 IRNIGAMIAPLHFLEVKLGKRPQPVKSEVRPLFSRQSPRFQLDEEEERRKRRREKNKVAAARCRN 214
             .::|:..|.......:.|...:|.:|      :..:|     |||::|..|||:||.||||||.
  Fly   385 -ASVGSSNANTSNTPARRGGGRRPNRS------TNMTP-----EEEQKRAVRRERNKQAAARCRK 437

Mouse   215 KKKERTEFLQRESERLELMNAELKTQIEELKLERQQLILMLNRHRPTC-IVRTDSVRTPESEG 276
            ::.::|..|..|.|:||.....::.:||.|...:.||..:|..||.|| .:|:|.:......|
  Fly   438 RRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHRATCQKIRSDMLSVVTCNG 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jdp2XP_011242520.1 PKc_like 128..>171 CDD:389743 5/42 (12%)
bZIP_ATF3 205..258 CDD:269870 20/52 (38%)
coiled coil 205..249 CDD:269870 17/43 (40%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 24/60 (40%)
coiled coil 421..480 CDD:269869 24/58 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.