DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAMK2D and lok

DIOPT Version :9

Sequence 1:NP_001308498.1 Gene:CAMK2D / 817 HGNCID:1462 Length:533 Species:Homo sapiens
Sequence 2:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster


Alignment Length:349 Identity:113/349 - (32%)
Similarity:173/349 - (49%) Gaps:61/349 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    14 YQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLS-AR------DHQKLEREARICRLLKHP 71
            |.:..:||.||:.:||......|.|::|.||:....|| ||      |..::..||:|.:.|.||
  Fly   174 YYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVLNEAKIMKNLSHP 238

Human    72 NIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQILESVNHCHLNGIVHRD 136
            .:||:||.:.:....|:|.:.:.||:|...|::.:..||..:.....|:..:|.:.|..||.|||
  Fly   239 CVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIISNKLLSEDISKLYFYQMCHAVKYLHDRGITHRD 303

Human   137 LKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVL---RKDPYGKPVDMW 198
            |||:|:||.:..:...:|::||||:..||.| .......|||.|::||||   .::.|.|.||:|
  Fly   304 LKPDNVLLETNDEETLLKVSDFGLSKFVQKD-SVMRTLCGTPLYVAPEVLITGGREAYTKKVDIW 367

Human   199 ACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPAKRITA 263
            :.||:|:..|.|..||.||......||||.|.:.:..|.|.:|:..||.|||:||.::|.:|.:.
  Fly   368 SLGVVLFTCLSGTLPFSDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAKLLINQMLIVDPERRPSI 432

Human   264 SEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKLKGAILTTMLATRNFSAAKSLLKKPDGVK 328
            .:.|:..|:..    |.|:.:                                ||.|:|. ||::
  Fly   433 DDVLQSSWLRD----APMLQK--------------------------------AKRLMKL-DGME 460

Human   329 INNKANVVTSPKENIPTPALEPQT 352
            |.         :||.    |||.|
  Fly   461 IE---------EENF----LEPPT 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAMK2DNP_001308498.1 STKc_CaMKII 12..303 CDD:270988 100/298 (34%)
CaMKII_AD 380..507 CDD:285524
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 97/267 (36%)
S_TKc 174..441 CDD:214567 97/267 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.