DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT2G20650 and PJA1

DIOPT Version :9

Sequence 1:NP_179657.2 Gene:AT2G20650 / 816593 AraportID:AT2G20650 Length:559 Species:Arabidopsis thaliana
Sequence 2:NP_001369704.1 Gene:PJA1 / 64219 HGNCID:16648 Length:643 Species:Homo sapiens


Alignment Length:78 Identity:23/78 - (29%)
Similarity:31/78 - (39%) Gaps:16/78 - (20%)


- Green bases have known domain annotations that are detailed below.


plant   484 VPRKLLPEKYSYYRRLDHN-VNRSRDCVICMTTIDLRHRINDCMVT--PCEHIFHSGCLQRWMDI 545
            :|..|:.|        ||. |.:...|.||.:     ..:...:.|  ||.|.||..|:..|:..
Human   577 LPEILVTE--------DHGAVGQEMCCPICCS-----EYVKGEVATELPCHHYFHKPCVSIWLQK 628

plant   546 KMECPTCRRPLPP 558
            ...||.||...||
Human   629 SGTCPVCRCMFPP 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT2G20650NP_179657.2 DUF2921 <405..483 CDD:402626
COG5540 <508..558 CDD:227827 15/51 (29%)
PJA1NP_001369704.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..363
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 380..454
RING-H2_PJA1_2 594..639 CDD:319379 15/49 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.