DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atf2 and kay

DIOPT Version :9

Sequence 1:NP_112280.1 Gene:Atf2 / 81647 RGDID:621862 Length:487 Species:Rattus norvegicus
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:417 Identity:96/417 - (23%)
Similarity:147/417 - (35%) Gaps:78/417 - (18%)


- Green bases have known domain annotations that are detailed below.


  Rat   125 STTNDEKEIPLAQTAQPTSAIVRPASLQVPNVLLTSSD------SSVIIQQAVPSPTSSTVI--- 180
            :|.|.......:.||  |||.....:....|..:.:|:      :.:.:||.....|..:|:   
  Fly   186 ATCNTTAAATTSTTA--TSAAAGSDNNHSDNFAMDASEIATFLANELFLQQLGNFETGQSVLTLT 248

  Rat   181 --TQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSVPGI 243
              |..|::.|.|....|..     |.:.||..||..|..         |||.|.|..:.....||
  Fly   249 TPTLTPTTTRNIEDTLGHL-----LSDTQTDRVAGCAGF---------AVPKVLPNAIDVLGMGI 299

  Rat   244 PGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGSGLVRAQSEESRPQSLQQ--------- 299
            |...|..|:|....:.|......:....:..||............|..:...|.|.         
  Fly   300 PTGVSSLPLQQTFDLSLGQGSESEDSNASYNDTQMNEEQDTTDTSSAHTDSTSYQAGHIMAGSVN 364

  Rat   300 -----------PATSTTETPASPAHTTPQTQNTSGRR------RRAANEDPDEKRRKFL--ERNR 345
                       .|.|::...||...:...|.||..||      .|:.|..|:|::::.:  |||:
  Fly   365 GGGVNNFSNVLAAVSSSRGSASVGSSNANTSNTPARRGGGRRPNRSTNMTPEEEQKRAVRRERNK 429

  Rat   346 AAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKS- 409
            .||:|||::|......|.::.|.|......::.|:.:|.|...||:.||..|:   .|..:.:| 
  Fly   430 QAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATHR---ATCQKIRSD 491

  Rat   410 --------------GYHTADKDDSSEDLSVPSSPHTEAIQHSSVSTSNGVSSTSKTEAGATSVLT 460
                          |..:|....|.     .||.|......||..|..|:.:|..:...:.|.|.
  Fly   492 MLSVVTCNGLIAPAGLLSAGSSGSG-----ASSHHNHNSNDSSNGTITGMDATLNSTGRSNSPLD 551

  Rat   461 QMADQSTEPALSQIVMAPSSQAQPSGS 487
            .....:.:..|..|...|...|..|||
  Fly   552 LKPAANIDSLLMHIKDEPLDGAIDSGS 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atf2NP_112280.1 C2H2 Zn finger 9..31 CDD:275370
GCN4_cent 47..84 CDD:213399
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 107..130 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 241..355 33/141 (23%)
Essential for its histone acetyltransferase activity. /evidence=ECO:0000250 278..281 0/2 (0%)
bZIP_ATF2 336..396 CDD:269835 19/61 (31%)
coiled coil 336..396 CDD:269835 19/61 (31%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 336..356 8/21 (38%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 362..390 6/27 (22%)
Nuclear export signal. /evidence=ECO:0000250 387..396 4/8 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 407..487 19/94 (20%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 19/60 (32%)
coiled coil 421..480 CDD:269869 19/58 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.