DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAP1LC3B and Atg8a

DIOPT Version :9

Sequence 1:NP_073729.1 Gene:MAP1LC3B / 81631 HGNCID:13352 Length:125 Species:Homo sapiens
Sequence 2:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster


Alignment Length:115 Identity:36/115 - (31%)
Similarity:66/115 - (57%) Gaps:2/115 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     7 FKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRL 71
            :|:...||:|..:...||.::|.::|||:|: ..:.::..|||.|:|||..:.:.:...:||:|:
  Fly     5 YKEEHAFEKRRAEGDKIRRKYPDRVPVIVEK-APKARIGDLDKKKYLVPSDLTVGQFYFLIRKRI 68

Human    72 QLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGM 121
            .|....|.|..|| :.:...|..:..:|:...:||.|||:.|:.:..:||
  Fly    69 HLRPEDALFFFVN-NVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYGM 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAP1LC3BNP_073729.1 Ubl_ATG8_MAP1LC3B 5..119 CDD:340755 34/111 (31%)
Atg8aNP_727447.1 GABARAP 5..116 CDD:176355 34/112 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1654
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54038
OrthoDB 1 1.010 - - D1508198at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.