DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NECTIN4 and Nectin4

DIOPT Version :9

Sequence 1:XP_011508323.1 Gene:NECTIN4 / 81607 HGNCID:19688 Length:511 Species:Homo sapiens
Sequence 2:XP_017454387.1 Gene:Nectin4 / 498281 RGDID:1559826 Length:509 Species:Rattus norvegicus


Alignment Length:511 Identity:479/511 - (93%)
Similarity:489/511 - (95%) Gaps:2/511 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MPLSLGAEMWGPEAWLLLLLLLASFTGRCPAGELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQV 65
            ||||||||||||||| ||||.|||||||..||||||||:||||||||||||||||||..||||||
  Rat     1 MPLSLGAEMWGPEAW-LLLLFLASFTGRYSAGELETSDLVTVVLGQDAKLPCFYRGDPDEQVGQV 64

Human    66 AWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVS 130
            ||||||..||.:||||||||||||||||||.|||||||||:|||||:||||||||||||||||||
  Rat    65 AWARVDPNEGTRELALLHSKYGLHVSPAYEDRVEQPPPPRDPLDGSILLRNAVQADEGEYECRVS 129

Human   131 TFPAGSFQARLRLRVLVPPLPSLNPGPALEEGQGLTLAASCTAEGSPAPSVTWDTEVKGTTSSRS 195
            ||||||||||:||||||||||||||||.||||||||||||||||||||||||||||||||.||||
  Rat   130 TFPAGSFQARMRLRVLVPPLPSLNPGPPLEEGQGLTLAASCTAEGSPAPSVTWDTEVKGTQSSRS 194

Human   196 FKHSRSAAVTSEFHLVPSRSMNGQPLTCVVSHPGLLQDQRITHILHVSFLAEASVRGLEDQNLWH 260
            |||||||||||||||||||||||||||||||||||||||||||.|.|:|||||||||||||||||
  Rat   195 FKHSRSAAVTSEFHLVPSRSMNGQPLTCVVSHPGLLQDQRITHTLQVAFLAEASVRGLEDQNLWH 259

Human   261 IGREGAMLKCLSEGQPPPSYNWTRLDGPLPSGVRVDGDTLGFPPLTTEHSGIYVCHVSNEFSSRD 325
            :|||||.|||||||||||.||||||||||||||||.|||||||||||||||:||||||||.|||.
  Rat   260 VGREGATLKCLSEGQPPPKYNWTRLDGPLPSGVRVKGDTLGFPPLTTEHSGVYVCHVSNELSSRA 324

Human   326 SQVTVDVLADPQEDSGKQVDLVSASVVVVGVIAALLFCLLVVVVVLMSRYHRRKAQQMTQKYEEE 390
            |||||:||||| ||.||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   325 SQVTVEVLADP-EDPGKQVDLVSASVVVVGVIAALLFCLLVVVVVLMSRYHRRKAQQMTQKYEEE 388

Human   391 LTLTRENSIRRLHSHHTDPRSQPEESVGLRAEGHPDSLKDNSSCSVMSEEPEGRSYSTLTTVREI 455
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   389 LTLTRENSIRRLHSHHTDPRSQPEESVGLRAEGHPDSLKDNSSCSVMSEEPEGRSYSTLTTVREI 453

Human   456 ETQTELLSPGSGRAEEEEDQDEGIKQAMNHFVQENGTLRAKPTGNGIYINGRGHLV 511
            |||||||||||||.|||:||||||||||||||||||||||||||||||||||||||
  Rat   454 ETQTELLSPGSGRTEEEDDQDEGIKQAMNHFVQENGTLRAKPTGNGIYINGRGHLV 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NECTIN4XP_011508323.1 IG_like 37..145 CDD:214653 96/107 (90%)
Ig1_Nectin-4_like 46..146 CDD:143296 89/99 (90%)
Ig2_Nectin-3-4_like 149..242 CDD:143328 89/92 (97%)
IG_like 259..332 CDD:214653 65/72 (90%)
IGc2 268..320 CDD:197706 48/51 (94%)
Nectin4XP_017454387.1 IgV_1_Nectin-4_like 37..145 CDD:409471 96/107 (90%)
Ig strand B 47..51 CDD:409471 3/3 (100%)
Ig strand C 63..67 CDD:409471 3/3 (100%)
Ig strand E 109..113 CDD:409471 2/3 (67%)
Ig strand F 123..128 CDD:409471 4/4 (100%)
Ig strand G 137..140 CDD:409471 2/2 (100%)
IgC1_2_Nectin-3-4_like 148..241 CDD:409501 89/92 (97%)
Ig strand B 166..170 CDD:409501 3/3 (100%)
Ig strand C 179..183 CDD:409501 3/3 (100%)
Ig strand E 205..209 CDD:409501 3/3 (100%)
Ig strand F 219..224 CDD:409501 4/4 (100%)
Ig strand G 234..237 CDD:409501 2/2 (100%)
Ig 265..328 CDD:409353 56/62 (90%)
Ig strand B 265..269 CDD:409353 2/3 (67%)
Ig strand C 278..282 CDD:409353 2/3 (67%)
Ig strand E 298..301 CDD:409353 2/2 (100%)
Ig strand F 311..316 CDD:409353 3/4 (75%)
Ig strand G 325..328 CDD:409353 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83693626
Domainoid 1 1.000 359 1.000 Domainoid score I12421
eggNOG 1 0.900 - - E1_2CRXB
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32744
Inparanoid 1 1.050 957 1.000 Inparanoid score I5818
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG43754
OrthoDB 1 1.010 - - D100891at9347
OrthoFinder 1 1.000 - - FOG0003314
OrthoInspector 1 1.000 - - oto133079
orthoMCL 1 0.900 - - OOG6_117588
Panther 1 1.100 - - LDO PTHR23277
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5723
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1818.270

Return to query results.
Submit another query.