DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NECTIN4 and him-4

DIOPT Version :9

Sequence 1:XP_011508323.1 Gene:NECTIN4 / 81607 HGNCID:19688 Length:511 Species:Homo sapiens
Sequence 2:NP_001024582.1 Gene:him-4 / 181187 WormBaseID:WBGene00001863 Length:5198 Species:Caenorhabditis elegans


Alignment Length:340 Identity:86/340 - (25%)
Similarity:136/340 - (40%) Gaps:85/340 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    33 ELE------TSDVVTV-------VLGQDAKLPCFYRGDSGEQVGQVAWAR-----VDAGEGAQEL 79
            |||      |..||:|       .||:...|.|   ..||....|:.||:     .|:.:||   
 Worm  3848 ELEMVLDVFTPPVVSVKSDNPIKALGETITLFC---NASGNPYPQLKWAKGGSLIFDSPDGA--- 3906

Human    80 ALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVL-LRNAVQADEGEYECRVSTFPAGSFQARLRL 143
                                     |..|.|:.| :.:..:.|.|:|.|:... .||:.:|.:.:
 Worm  3907 -------------------------RISLKGARLDIPHLKKTDVGDYTCQALN-AAGTSEASVSV 3945

Human   144 RVLVPP---LPSLNPGPALEEGQGLTLAASCTAEGSPAPSVTWDTEVKGTTSSRSFKHSR---SA 202
            .|||||   ...::..|.|...|.|||  .|.|:|.|.|.:.|      |.:..:..||.   :.
 Worm  3946 DVLVPPEINRDGIDMSPRLPAQQSLTL--QCLAQGKPVPQMRW------TLNGTALTHSTPGITV 4002

Human   203 AVTSEFHLVPSRSMNGQPL-TC----VVSHPGLLQDQRITHILHVSFLAEASVRGLEDQNLWHIG 262
            |..|.|..:.:.|::.:.: ||    |.....|:.:   ..::....::....:.:       |.
 Worm  4003 ASDSTFIQINNVSLSDKGVYTCYAENVAGSDNLMYN---VDVVQAPVISNGGTKQV-------IE 4057

Human   263 REGAMLKCLSEGQPPPSYNWTRLDGPLPSGVR-----VDGDTLGFPPLTTEHSGIYVCHVSNEFS 322
            .|.|:::||.||.|.|..:|.|....:.:||:     .||..|......:..||||:|..:||..
 Worm  4058 GELAVIECLVEGYPAPQVSWLRNGNRVETGVQGVRYVTDGRMLTIIEARSLDSGIYLCSATNEAG 4122

Human   323 SRDSQVTVDVLADPQ 337
            |.....|::||..|:
 Worm  4123 SAQQAYTLEVLVSPK 4137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NECTIN4XP_011508323.1 IG_like 37..145 CDD:214653 26/120 (22%)
Ig1_Nectin-4_like 46..146 CDD:143296 21/105 (20%)
Ig2_Nectin-3-4_like 149..242 CDD:143328 24/103 (23%)
IG_like 259..332 CDD:214653 25/77 (32%)
IGc2 268..320 CDD:197706 18/56 (32%)
him-4NP_001024582.1 IG_like 442..515 CDD:214653
IG 527..605 CDD:214652
Ig 628..694 CDD:319273
I-set 702..789 CDD:369462
I-set 793..881 CDD:369462
Ig 899..974 CDD:386229
I-set 1012..1081 CDD:369462
Ig 1109..1172 CDD:319273
Ig 1196..1263 CDD:319273
IG_like 1277..1358 CDD:214653
I-set 1373..1450 CDD:369462
Ig 1474..1544 CDD:386229
IGc2 1563..1628 CDD:197706
Ig 1651..1732 CDD:386229
Ig 1755..1818 CDD:319273
Ig 1839..1912 CDD:386229
Ig 1930..2002 CDD:386229
IG_like 2014..2095 CDD:214653
Ig 2094..2182 CDD:386229
Ig 2190..2283 CDD:386229
I-set 2296..2380 CDD:369462
Ig 2384..2471 CDD:386229
IGc2 2492..2556 CDD:197706
Ig 2580..2654 CDD:386229
Ig 2686..2753 CDD:319273
IG_like 2768..2850 CDD:214653
I-set 2854..2939 CDD:369462
IG_like 2951..3031 CDD:214653
I-set 3046..3116 CDD:369462
I-set 3127..3213 CDD:369462
Ig 3217..3292 CDD:386229
I-set 3300..3386 CDD:369462
I-set 3396..3472 CDD:369462
I-set 3481..3569 CDD:369462
I-set 3591..3663 CDD:369462
Ig 3667..3762 CDD:386229
Ig 3775..3848 CDD:386229 86/340 (25%)
Ig 3859..3947 CDD:386229 26/119 (22%)
IGc2 3968..4031 CDD:197706 20/70 (29%)
Ig_3 4045..4119 CDD:372822 21/80 (26%)
Ig_3 4136..4210 CDD:372822 1/2 (50%)
Ig <4262..4314 CDD:386229
Ig 4318..4406 CDD:386229
IG_like 4418..4496 CDD:214653
I-set 4570..4654 CDD:369462
I-set 4752..4836 CDD:369462
EGF_CA 4996..5027 CDD:238011
EGF_CA 5034..5076 CDD:214542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23277
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.