DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TMX1 and CG9302

DIOPT Version :10

Sequence 1:NP_110382.3 Gene:TMX1 / 81542 HGNCID:15487 Length:280 Species:Homo sapiens
Sequence 2:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster


Alignment Length:134 Identity:32/134 - (23%)
Similarity:59/134 - (44%) Gaps:25/134 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    23 WTHGRRSNVRVITDENWRELL--EGDWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVN------ 79
            |:....|.:..:|.:.:...|  |...::.||||||..|:.::||:|..|     ||:.      
  Fly   265 WSADTNSEIVHLTSQGFEPALKDEKSALVMFYAPWCGHCKRMKPEYEKAA-----LEMKQKKIPG 324

Human    80 -IAKVDVTEQPGLSGRFIITALPTIYHCKDGEFRRYQGPRTKKDFINFISD-----------KEW 132
             :|.:|.|::|.::.::.:...||:....:|.|:.....|.....:.|:.|           |.|
  Fly   325 LLAALDATKEPSIAEKYKVKGYPTVKFFSNGVFKFEVNVREASKIVEFMRDPKEPPPPPPPEKSW 389

Human   133 KSIE 136
            :..|
  Fly   390 EEEE 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TMX1NP_110382.3 PDI_a_TMX 29..129 CDD:239292 27/108 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..280
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295
PDI_a_PDIR 272..373 CDD:239295 25/105 (24%)
PDI_a_PDIR 397..498 CDD:239295
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.