DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC38A1 and CG7888

DIOPT Version :9

Sequence 1:NP_001265319.1 Gene:SLC38A1 / 81539 HGNCID:13447 Length:503 Species:Homo sapiens
Sequence 2:NP_648425.1 Gene:CG7888 / 39232 FlyBaseID:FBgn0036116 Length:465 Species:Drosophila melanogaster


Alignment Length:521 Identity:107/521 - (20%)
Similarity:200/521 - (38%) Gaps:123/521 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    35 ENGQINSKFISDRESRRSLTNSHLEKK----KCDEYIP-------GTTSLGMSVFNLSNAIMGSG 88
            :||..||.:::|...:..|.....:.|    |..:|.|       ..|:...::|:|....:|:|
  Fly     6 KNGHSNSAYVADHPDKLELAEKGQKNKAVVAKDPDYNPYHHRDVEHPTTNSETLFHLLKGSLGTG 70

Human    89 ILGLAFALANTGILLFLVLLTSVTLLSIYSINLLL-----IC-SKETGCMVYEKLGEQVFGTTGK 147
            ||.:..|..|:|.:...:....:..:..:.|:.|:     :| .|:...|.|..:.|...|...|
  Fly    71 ILAMPNAFRNSGYITGSIGTIVIGFICTFCIHQLVKAQYELCRRKKMPSMNYPMVAETAMGEGPK 135

Human   148 -FVIFG--ATSLQNT-------GAMLSYLFIVKNELPSAIKFLMGKEETFSAWYVDGRVLVVIVT 202
             |.:|.  ..::.||       |....|:..|.:.:.:.:       :..:...:|.|:.::|  
  Fly   136 CFRVFAPYIGTVVNTFLLIYQLGTCCVYVVFVASNIKAIV-------DAVADTSIDVRLCMII-- 191

Human   203 FGIILPLCLL---KNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTNADTC 264
              |:|||.|:   :||.||...|..:.:..:....::.|..|:.|                    
  Fly   192 --ILLPLILINWVRNLKYLAPFSTLANAITMVSFGIICYYIFREP-------------------- 234

Human   265 TPKYVTFNSKTVYALP--------TIAFAFVCHPSVLPIYSELKDRSQKKMQ---MVSNISFFAM 318
                ||...|..:..|        |:.||......:||:.:|:|  :.:|..   .|.|:|...:
  Fly   235 ----VTTEGKDAFGKPSNFPLFFGTVLFALEAIGVILPLENEMK--TPQKFGGSCGVLNVSMVLI 293

Human   319 FVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDDILILTVR------------LAVIVAVILT---- 367
            ..:|....:||||.:...|...:... ..:.::|.:.|:            ||..||:.:|    
  Fly   294 VFLYVGMGLFGYLNYGSAVLGSITLN-MPEHEVLSMCVKGMLAFAIYITHGLACYVAIDITWNDY 357

Human   368 VPVLFFTVRSSLF-ELAKKTKFNLCRHTVVTCILLVVINLLVIFIPSMKDIFGVVGVTSANMLIF 431
            |.......|::|| |.|.:|.            |:::..||.:.||:::....:.|....:.|..
  Fly   358 VAKRLGAQRNALFWEYAVRTG------------LVLITFLLAVAIPNLELFISLFGALCLSALGL 410

Human   432 ILPSSLYLKITDQDGDKGTQRIWLFLFLQFPVQPCWLSECIILLPAALSL---NMLKRKELIILC 493
            ..|:.:.: .|.....||..::||.           ||..::::...|.|   .....||:::..
  Fly   411 AFPALIQI-CTHWYNTKGFAKVWLV-----------LSNFVLIIVGILGLVIGTYTSLKEIVLTF 463

Human   494 S 494
            |
  Fly   464 S 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC38A1NP_001265319.1 SLC5-6-like_sbd 69..480 CDD:382020 92/457 (20%)
CG7888NP_648425.1 SLC5-6-like_sbd 51..453 CDD:294310 94/463 (20%)
SdaC 62..456 CDD:223884 92/455 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158623
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.