DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC38A1 and path

DIOPT Version :9

Sequence 1:NP_001265319.1 Gene:SLC38A1 / 81539 HGNCID:13447 Length:503 Species:Homo sapiens
Sequence 2:NP_001261634.1 Gene:path / 39106 FlyBaseID:FBgn0036007 Length:471 Species:Drosophila melanogaster


Alignment Length:433 Identity:92/433 - (21%)
Similarity:171/433 - (39%) Gaps:71/433 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    48 ESRRSLTNSHLEKKKCDEYI----PGTTSLGMSVFNLSNAIMGSGILGLAFALANTGILLFLVLL 108
            :.|:|.|...|.....|.:.    |..|:...::.:|..|.:|:||||:.||...:|:::.:...
  Fly    31 QPRKSDTEQALAGNDFDPFALRDNPHPTTDNETLTHLLKASLGTGILGMPFAFMCSGLIMGIFST 95

Human   109 TSVTLLSIYSINLLLIC-------SKETGCMVYEKLGEQV----------FGTTGKFVIFGATSL 156
            .....:..:...:|:.|       ::.|. |.:.::.|..          |....||.|.....|
  Fly    96 IFTAFICTHCSYVLVKCGHKLYYRTRRTK-MTFAEIAEAAFQKGPKWCRGFAPVAKFSILFGLFL 159

Human   157 QNTGAMLSYLFIVKNELPSAIKFLMGKEETFSAWYVDGRVLVVIVTFGIILPLCLLKNLGYLGYT 221
            ...|....|..||.:.....|.:..|..       |..|:|:.|    :::||.|:..:..|.|.
  Fly   160 TYFGTCSVYTVIVASNFEQLISYWTGTA-------VSLRMLICI----MLVPLILIAWVPNLKYL 213

Human   222 SGFSLSCMVFF---LIVVIYKKFQIPCIVPELNSTISANSTNADTCTPKYVTFNSKTVYALPTIA 283
            :..|:...||.   |.:..|...|....|.|..|.:.:.       .|:   |.|.|::|:..|.
  Fly   214 APVSMVANVFMGLGLGITFYYLVQDLPPVEERESVVWST-------LPQ---FFSITIFAMEAIG 268

Human   284 FAFVCHPSVLPIYSELKDRSQKKMQMVSNIS--FFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQ 346
            .       |:|:.:.:| ..|..:.:...:|  ...:.::|.|....|||. |.:...:.:....
  Fly   269 V-------VMPLENNMK-TPQSFLGICGVLSQGMSGVTLIYMLLGFLGYLR-YGSATGESITLNL 324

Human   347 SKDDILILTVRLAVIVAVILTVPVLFFT----VRSSLFELAKKTKFNLCRHTVVTCILLVVI--- 404
            ..::....||::.:.:||..|..:.||.    :...:.|..||      |.|:|..:|..|:   
  Fly   325 PIEEWPAQTVKVLISLAVYCTFGLQFFVCLEIIWDGIKEKCKK------RPTLVNYVLRTVLVTA 383

Human   405 -NLLVIFIPSMKDIFGVVGVTSANMLIFILPSSLYLKITDQDG 446
             .:|.:.:|::....|::|....::|..|.|..:.|.:..:.|
  Fly   384 AVVLAVAVPTIGPFMGLIGAFCFSILGLIFPVVIELIVHWESG 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC38A1NP_001265319.1 SLC5-6-like_sbd 69..480 CDD:382020 86/408 (21%)
pathNP_001261634.1 SLC5-6-like_sbd 56..456 CDD:294310 86/408 (21%)
SdaC 67..445 CDD:223884 85/397 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.