DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC38A1 and CG1139

DIOPT Version :9

Sequence 1:NP_001265319.1 Gene:SLC38A1 / 81539 HGNCID:13447 Length:503 Species:Homo sapiens
Sequence 2:NP_647686.1 Gene:CG1139 / 38264 FlyBaseID:FBgn0035300 Length:451 Species:Drosophila melanogaster


Alignment Length:506 Identity:100/506 - (19%)
Similarity:188/506 - (37%) Gaps:141/506 - (27%)


- Green bases have known domain annotations that are detailed below.


Human     4 FKSGLELTELQNMTVPEDDNISNDSND---FTEVENGQINSKFISDRESRRSLTNSHLEKKKCDE 65
            :.:.||||     |..:..|.|||..|   ..|::|...|.:           |.:|..|     
  Fly    11 YPTTLELT-----TPTKSANGSNDDYDPHQHRELKNPTTNFQ-----------TFAHFLK----- 54

Human    66 YIPGTTSLGMSVFNLSNAIMGSGILGLAFALANTGILLFLVLLTSVTLLSIYSINLL-----LIC 125
                             |.:|:|:|.:..|.|:.|.:...:|...:..|::|.:::|     ::|
  Fly    55 -----------------ASVGTGVLAMPSAFAHAGYVNGTLLTLIIGSLALYCLHILIKCMYILC 102

Human   126 SKETGCMVYEKLGEQV------------------------------FGTTGKFVIFGATSLQNTG 160
            .::.  :.|....:.:                              ||....:|:|.|.|     
  Fly   103 KRQR--VPYVSFSQAMNLGLKQGPPWLRCLAPIAVPFVDGFLAFYHFGICCVYVVFIAES----- 160

Human   161 AMLSYLFIVKNELPSAIKFLMGKEETFSAWYVDGRVLVVIVTFGIILPLCL---LKNLGYLG-YT 221
                            ||.|:  :|....|  |.|:.:.|    ||:||.|   :|||..|. ::
  Fly   161 ----------------IKQLV--DEYLVVW--DVRIHMCI----IIVPLLLIYSIKNLKLLAPFS 201

Human   222 SGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTNADTCTPKYVTFNSKTVYALPTIAFAF 286
            |..:|..:|.|.|::.|...::|.: .|.:..::|.         |..||....::||..:..  
  Fly   202 SAANLLLLVGFGIILYYIFEELPPL-SERDPFVAAG---------KLPTFFGTVLFALEAVGV-- 254

Human   287 VCHPSVLPIYSEL-KDRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDL-LHKYQSKD 349
                 :|.|...: ..:|......:.|.....:..:|.|...|||..:.:..:..: |:..||:.
  Fly   255 -----ILAIEENMATPKSFVGPCGILNSGMSIVLGLYVLLGFFGYWKYGNESEGSITLNIPQSEI 314

Human   350 DILILTVRLAVIVAV------ILTVPVLFFTVRSSLFELAKKTKFNLCRHTVVTCILLVVINLLV 408
            ...::.|..|:...:      .:|..:|:....:..|:..::|.:.|    :...|::::.....
  Fly   315 PAQVVKVFFAITTWISYALQGYVTAHILWDKYLAKRFKETRQTFYEL----IFRAIIVLLTFGCA 375

Human   409 IFIPSMKDIFGVVGVTSANMLIFILPSSLYLKITDQDGDKGTQRIWLFLFL 459
            :.||.:.....:||....::|..|.|..|.:.:...:| .|..||.|.:.|
  Fly   376 VAIPDLSVFLSLVGSFCLSILGLIFPVLLQICVQYTEG-YGPFRIKLIINL 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC38A1NP_001265319.1 SLC5-6-like_sbd 69..480 CDD:382020 84/438 (19%)
CG1139NP_647686.1 SdaC 36..404 CDD:223884 83/452 (18%)
SLC5-6-like_sbd 42..444 CDD:294310 88/470 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158621
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.