DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC38A1 and CG13743

DIOPT Version :9

Sequence 1:NP_001265319.1 Gene:SLC38A1 / 81539 HGNCID:13447 Length:503 Species:Homo sapiens
Sequence 2:NP_610444.2 Gene:CG13743 / 35911 FlyBaseID:FBgn0033368 Length:528 Species:Drosophila melanogaster


Alignment Length:396 Identity:109/396 - (27%)
Similarity:185/396 - (46%) Gaps:47/396 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    71 TSLGMSVFNLSNAIMGSGILGLAFALANTGILLFLVLLTSVTLLSIYSINLLLICSKETGCMVYE 135
            :||..:.||..|:|:|||::|:.:||...|..|.|.||..|..::.||:.|::.|....|...|.
  Fly    95 SSLPQASFNYINSIVGSGVIGIPYALHRAGFGLGLALLILVAYITDYSLILMVRCGHICGRFSYP 159

Human   136 KLGEQVFGTTGKFVIFGATSLQNTGAMLSYLFIVKNELPSA-IKFLMGKEETFSAWYVD-GRV-- 196
            .:.|..:|..|.:::.....:....||:||..:|.:.|... ::|       |.:|... |.|  
  Fly   160 GIMEAAYGKYGYYLLSLLQFMYPFLAMISYNVVVGDTLSKVLVRF-------FPSWGGSMGAVRL 217

Human   197 -LVVIVTFGIILPLCLLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTN 260
             :|..|..|:::||||.||:..|...|..||:|:||.|..||.|             .:|.:...
  Fly   218 GVVFFVNVGVVMPLCLYKNVSRLARASFISLACVVFILFAVIIK-------------LMSGDYKV 269

Human   261 ADTCTPKYVTFNSKTVYALPTIAFAFVCHPSVLPIYSELKDRSQKKMQMVSNISFFAMFVMYFLT 325
            .|| ...:...||..:.|...:.|||:||.:...:|..::|.:.::.:.|::||....:.:..|.
  Fly   270 TDT-AESWRFANSDLIPATGIMVFAFMCHHNTFLVYQSMRDATMERWEKVTHISIGFAWTVAALF 333

Human   326 AIFGYLTFYDNVQSDLLHKYQSKDDILILTVRLAVIVAVILTVPVLFFTVRSSLFELAKK----- 385
            .|.||.||....|.|||..|...||::..: |:...::::||.|:..|..|..:..|..:     
  Fly   334 GIAGYSTFRALSQGDLLENYCWDDDLMNFS-RVLFSISILLTFPIECFVSREIVRALVHRFVLKE 397

Human   386 --TKFNLCRHTVVTCILLV-----VINLLVIF----IPSMKDIFGVV----GVTSANMLIFILPS 435
              ::|...:...:....::     .|.:.::|    |..|.|..|.|    |:.:|..|.:|||.
  Fly   398 PISEFTQDKDPSLEKGAIIDEYSKAITMAIVFSAFVISPMTDCLGSVLELNGLLAAIPLAYILPG 462

Human   436 SLYLKI 441
            ..|:::
  Fly   463 LAYIQM 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC38A1NP_001265319.1 SLC5-6-like_sbd 69..480 CDD:382020 109/396 (28%)
CG13743NP_610444.2 SLC5-6-like_sbd 95..500 CDD:294310 109/396 (28%)
SdaC 95..491 CDD:223884 109/396 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100459
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.