DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC38A1 and CG4991

DIOPT Version :9

Sequence 1:NP_001265319.1 Gene:SLC38A1 / 81539 HGNCID:13447 Length:503 Species:Homo sapiens
Sequence 2:NP_001259638.1 Gene:CG4991 / 32695 FlyBaseID:FBgn0030817 Length:496 Species:Drosophila melanogaster


Alignment Length:465 Identity:83/465 - (17%)
Similarity:173/465 - (37%) Gaps:98/465 - (21%)


- Green bases have known domain annotations that are detailed below.


Human     8 LELTELQNMTVPEDDNISNDSNDFT--------EVENGQINSKFISDRESRRSLTNSHLEKKKCD 64
            ||:|..||     |.::..:...||        :.|||        |...||....|.||     
  Fly    42 LEITGRQN-----DKSLEKNPERFTKNVTEKGADPENG--------DPVRRRGHETSELE----- 88

Human    65 EYIPGTTSLGMSVFNLSNAIMGSGILGLAFALANTGILLFLVLLTSVTLLSIYSINLL-----LI 124
                       :..:|....:|:|:..:.....|.|:....:||..:.::.::...:|     |.
  Fly    89 -----------AATHLFKGSVGAGLFAMGDCFKNGGLAGATILLPIIAVMCVHCERMLIRGSVLA 142

Human   125 CSKETGC--MVYEKLGEQVFGTTGKFVIFGATSLQNTGAMLSY---LFIVKNELP-SAIKFLMGK 183
            ..:..|.  :.|.:..|:.|.       .|...|:....::..   :|:...:.. .||.|:...
  Fly   143 VERTPGVDFLDYPETVEKCFE-------HGPRPLRKMSRVMKLIVEMFLCVTQFGFCAIYFVFIT 200

Human   184 EETFSAWYVDGRV----LVVIVTFGIILPL---CLLKNLGYLGYTSGFSLSCMVFFLIVVIYKKF 241
            |........:|.|    :|:::|   :||.   .|:.||.|:...|.|:...::|.||..:...|
  Fly   201 ENLHQVLQQNGIVISMSMVMLIT---LLPAMIPSLMTNLKYISPVSLFANVALLFGLIATLTIAF 262

Human   242 Q---IPCIVPELNSTISANSTNADTCTPKYVTFNSKTVYALPTIAFAFVCHPSVLPIYSELK--D 301
            .   :|          |....:..|...:...|....:::...||.       :||:.:.::  :
  Fly   263 SDGPMP----------SVGDRHLFTGGAQLALFFGTALFSYEGIAL-------ILPLRNSMRRPE 310

Human   302 RSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDDILILTVRLAVIVAVIL 366
            :...:..::::..||.. .::..|....|:.:.:.|...:.... ..:::....|::...:.|.|
  Fly   311 KFSTRFGVLNSTMFFTT-ALFIFTGFVSYVRWGEEVAGSITLNL-VVEEVFSQVVKVIAALGVFL 373

Human   367 TVPVLFFTVRSSLFELAKKTKFNLCRH----TVVTCILLVVINL---LVIFIPSMKDIFGVVGVT 424
            ..|:.||.:...|:...|::  |.|..    |...|:...::.:   :.:.:|.:.....::|..
  Fly   374 GYPIQFFVMIKILWPPLKRS--NNCTQKYPITSQVCLRFFMVMMTFGVALVVPKLNLFISLIGAL 436

Human   425 SANMLIFILP 434
            .:..|.|::|
  Fly   437 CSTCLAFVIP 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC38A1NP_001265319.1 SLC5-6-like_sbd 69..480 CDD:382020 66/396 (17%)
CG4991NP_001259638.1 SLC5-6-like_sbd 82..489 CDD:294310 69/412 (17%)
SdaC 84..488 CDD:223884 69/410 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158576
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54358
OrthoDB 1 1.010 - - D697331at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.