DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TAF15 and NRP1

DIOPT Version :10

Sequence 1:NP_631961.1 Gene:TAF15 / 8148 HGNCID:11547 Length:592 Species:Homo sapiens
Sequence 2:NP_010114.1 Gene:NRP1 / 851387 SGDID:S000002326 Length:719 Species:Saccharomyces cerevisiae


Alignment Length:36 Identity:18/36 - (50%)
Similarity:24/36 - (66%) Gaps:2/36 - (5%)


- Green bases have known domain annotations that are detailed below.


Human   353 PKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSR 388
            |:.|||.|  ||||..||.||.:|.:|:.|.|.:|:
Yeast   354 PRPGDWNC--PSCGFSNFQRRTACFRCSFPAPSNSQ 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TAF15NP_631961.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..237
ser_rich_anae_1 <2..>124 CDD:468206
SF-CC1 136..>315 CDD:273721
RRM_FUS_TAF15 232..317 CDD:409951
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..356 1/2 (50%)
zf-RanBP 354..384 CDD:395516 15/29 (52%)
RanBP2-type Zn finger 358..379 CDD:275375 11/20 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 373..592 6/16 (38%)
21 X approximate tandem repeats of D-R-[S,G](0,3)-G-G-Y-G-G 407..575
NRP1NP_010114.1 RRM_ARP_like 226..328 CDD:409886
zf-RanBP 355..384 CDD:395516 15/30 (50%)
RanBP2-type Zn finger 359..378 CDD:275376 11/20 (55%)
zf-RanBP 581..609 CDD:395516
RanBP2-type Zn finger 585..604 CDD:275376
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.