| Sequence 1: | NP_631961.1 | Gene: | TAF15 / 8148 | HGNCID: | 11547 | Length: | 592 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_611692.1 | Gene: | CG3732 / 37588 | FlyBaseID: | FBgn0034750 | Length: | 282 | Species: | Drosophila melanogaster |
| Alignment Length: | 273 | Identity: | 62/273 - (22%) |
|---|---|---|---|
| Similarity: | 81/273 - (29%) | Gaps: | 63/273 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Human 345 GFQGRGGDPKSGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRG 409
Human 410 GR-----------GGDRGGYGGDRSGGGYGGD-------------------RSSGGGYSGDRSGG 444
Human 445 GYGGDRSGGGYGGDRGGGYGGDRGGG------YGGDRGGGYGGDRGGYGGDRGGGYGGDRGGYGG 503
Human 504 DRGGYGGD-----RGGYGGD-----------RGGYGGDRSRGGYGGDRGGGSGYGGDRSGGYGGD 552
Human 553 RSGGGYGGDRGGG 565 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| TAF15 | NP_631961.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..237 | ||
| G_path_suppress | <1..124 | CDD:318248 | |||
| RRM | 136..>315 | CDD:330708 | |||
| RRM_FUS_TAF15 | 232..317 | CDD:240979 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 324..356 | 3/10 (30%) | |||
| zf-RanBP | 354..384 | CDD:279035 | 14/29 (48%) | ||
| RanBP2-type Zn finger | 358..379 | CDD:275375 | 11/20 (55%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 373..592 | 49/245 (20%) | |||
| 21 X approximate tandem repeats of D-R-[S,G](0,3)-G-G-Y-G-G | 407..575 | 38/211 (18%) | |||
| CG3732 | NP_611692.1 | ZnF_RBZ | 22..46 | CDD:197784 | 13/23 (57%) |
| RanBP2-type Zn finger | 24..45 | CDD:275376 | 11/20 (55%) | ||
| zf-RanBP | 100..129 | CDD:279035 | 0/28 (0%) | ||
| RanBP2-type Zn finger | 104..123 | CDD:275376 | 0/18 (0%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1995 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||