DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MPK17 and rl

DIOPT Version :9

Sequence 1:NP_001030939.1 Gene:MPK17 / 814673 AraportID:AT2G01450 Length:486 Species:Arabidopsis thaliana
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:350 Identity:152/350 - (43%)
Similarity:223/350 - (63%) Gaps:18/350 - (5%)


- Green bases have known domain annotations that are detailed below.


plant    12 EASQYQIQEV---------VGKGSYGVVASAECPHTGGKVAIKKMTNVFEHVSDAIRILREIKLL 67
            |..:.||.||         :|:|:||:|.||:...|..:|||||: :.|||.:...|.||||.:|
  Fly    25 EVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKI-SPFEHQTYCQRTLREITIL 88

plant    68 RLLRHPDIVEIKHIMLPPCRKEFKDIYVVFELMESDLHHVLKVNDDLTPQHHQFFLYQLLRGLKF 132
            ...:|.:|::|:.|:......:.:|:|:|..|||:||:.:|| ...|:..|..:||||:|||||:
  Fly    89 TRFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLK-TQRLSNDHICYFLYQILRGLKY 152

plant   133 MHSAHVFHRDLKPKNILANADCKIKICDLGLARVSFTDSPSAVFWTDYVATRWYRAPELCGSFYS 197
            :|||:|.||||||.|:|.|..|.:||||.||||::..:.....|.|:|||||||||||:..: ..
  Fly   153 IHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLN-SK 216

plant   198 NYTPAIDMWSVGCIFAEMLTGKPLFPGKNVVHQLELVTDLLGTPSPITLSRIRNEKARKYLGNMR 262
            .||.:||:||||||.||||:.:|:||||:.:.||..:..:||:||...|..|.|||||.||.::.
  Fly   217 GYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLP 281

plant   263 RKDPVPFTHKFPNIDPVALKLLQRLIAFDPKDRPSAEEALADPYFQGLANVDYEPSRQPISKLEF 327
            .|..||:...|||.|.:||.||.:::.|:|..|...|||||.||.:..    |:|..:|::::.|
  Fly   282 FKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQY----YDPGDEPVAEVPF 342

plant   328 --EFERRKLTRDDVRELMYREILEY 350
              ..|...::||.::.|::.|.|::
  Fly   343 RINMENDDISRDALKSLIFEETLKF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MPK17NP_001030939.1 STKc_TDY_MAPK 15..352 CDD:143364 151/346 (44%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 148/340 (44%)
S_TKc 38..326 CDD:214567 136/290 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.