DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAMK4 and CG10177

DIOPT Version :9

Sequence 1:NP_001310303.1 Gene:CAMK4 / 814 HGNCID:1464 Length:473 Species:Homo sapiens
Sequence 2:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster


Alignment Length:270 Identity:77/270 - (28%)
Similarity:132/270 - (48%) Gaps:17/270 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    40 DALSDFFEVESELGRGATSIVYRCKQKGTQKPYALKVLKKTV---DKKIVRTEIGVLLRL-SHPN 100
            :|:..:.|....:.....:::||.:.:..:....:|::.|..   |:.....|..||.:| ||||
  Fly   143 EAIQLYIETIEPVEHNTRTLIYRGQTRANRTKCTVKMVNKQTQSNDRGDTYMEAEVLRQLQSHPN 207

Human   101 IIKLKEIFETPTEISLVLELVTGGELFDRIVEK-GYYSERDAADAVKQILEAVAYLHENGIVHRD 164
            ||:|....|....:..|||.:...  ..::::| |..||.||...::..:.|:|::|:..::|||
  Fly   208 IIELMYTVEDERYMYTVLEHLDCN--MQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRD 270

Human   165 LKPENLLYATPAPD---APLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWS 226
            :||||||..:.:..   ..:|:|:|.|:.......|. ..||||.|.|||::....|..:||.||
  Fly   271 IKPENLLVCSSSGKWNFKMVKVANFDLATYYRGSKLY-VRCGTPCYMAPEMIAMSGYDYQVDSWS 334

Human   227 VGIITYILLCGFEPFYDE-RGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKR-- 288
            :|:..:.:|||..||... :..:.::..|::....:.......:|..|..|:..|:|.||..|  
  Fly   335 LGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVP 399

Human   289 ---LTTFQAL 295
               |..||.|
  Fly   400 IAELDKFQFL 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAMK4NP_001310303.1 STKc_CaMKIV 42..335 CDD:270987 76/268 (28%)
Pkinase 46..300 CDD:278497 76/264 (29%)
Autoinhibitory domain 305..321
PP2A-binding 306..323
Calmodulin-binding. /evidence=ECO:0000255 322..341
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 445..473
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 74/247 (30%)
PKc_like 164..403 CDD:304357 71/241 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.