DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CALR and CG1924

DIOPT Version :10

Sequence 1:NP_004334.1 Gene:CALR / 811 HGNCID:1455 Length:417 Species:Homo sapiens
Sequence 2:NP_572788.2 Gene:CG1924 / 32180 FlyBaseID:FBgn0030377 Length:570 Species:Drosophila melanogaster


Alignment Length:82 Identity:17/82 - (20%)
Similarity:28/82 - (34%) Gaps:28/82 - (34%)


- Green bases have known domain annotations that are detailed below.


Human   117 RMFRRTYTSV-GPTYSTAV-----------------HN--------CLKNLDLWCFDVFSLNRAA 155
            :|.||....: |.|:...|                 ||        ||..::.|.::||...:. 
  Fly    48 QMIRRILEDIYGGTWGVLVIRDPALVSKDVHWTFPDHNNLDGSPAFCLTVVNEWQYNVFKTGQI- 111

Human   156 DDHALRTIVFELLTRHS 172
             |...|..:..::.|.|
  Fly   112 -DSPQRVTIDNMIQRFS 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CALRNP_004334.1 N-domain 18..197 17/82 (21%)
Calreticulin 23..332 CDD:459737 17/82 (21%)
4 X approximate repeats 191..255
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..278
P-domain 198..308
Interaction with PPIB. /evidence=ECO:0000250 237..270
3 X approximate repeats 259..297
C-domain 309..417
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..417
Prevents secretion from ER 414..417
CG1924NP_572788.2 Calreticulin 70..425 CDD:459737 11/60 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.