DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PABPN1 and SC35

DIOPT Version :10

Sequence 1:NP_004634.1 Gene:PABPN1 / 8106 HGNCID:8565 Length:306 Species:Homo sapiens
Sequence 2:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster


Alignment Length:167 Identity:51/167 - (30%)
Similarity:72/167 - (43%) Gaps:35/167 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   151 PPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGF 215
            |||...|.|             |:.|.|:.|..|.|:|...|..||.|..:.|..|:::...:||
  Fly    15 PPPRIDGMV-------------SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 66

Human   216 AYIEFSDKESVRTSL-ALDESLFRGRQIKVIPKRTNRPGISTTD----RG-------FPRARYRA 268
            |::.|.||.....:| |:|..:..||:::|...|..||...|..    ||       ..|.|.|:
  Fly    67 AFVRFYDKRDAEDALEAMDGRMLDGRELRVQMARYGRPSSPTRSSSGRRGGGGGGGSGGRRRSRS 131

Human   269 RTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSP 305
            |:.....|||         ||.|.| .|:|:...:||
  Fly   132 RSPMRRRSRS---------PRRRSY-SRSRSPGSHSP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PABPN1NP_004634.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115
Interaction with SKIP. /evidence=ECO:0000269|PubMed:11371506 2..145
GCG-encoded polyalanine repeat 2..7
Stimulates PAPOLA. /evidence=ECO:0000250 119..147
Necessary for homooligomerization 155..306 48/163 (29%)
RRM_II_PABPN1 173..248 CDD:409966 25/75 (33%)
Interaction with PAPOLA. /evidence=ECO:0000250 286..306 8/20 (40%)
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 23/71 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.