DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PABPN1 and Hrb87F

DIOPT Version :10

Sequence 1:NP_004634.1 Gene:PABPN1 / 8106 HGNCID:8565 Length:306 Species:Homo sapiens
Sequence 2:NP_476806.2 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster


Alignment Length:131 Identity:38/131 - (29%)
Similarity:57/131 - (43%) Gaps:19/131 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   138 ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVT 202
            |.:..|.:|...||   |||           |..:.::||.:......|.|..:|...|.:..|.
  Fly    95 EPKRAVPR
QEIDSP---NAG-----------ATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVN 145

Human   203 ILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQI---KVIPKR-TNRPGISTTDRGFPR 263
            |:.||.:|..:|||:|||.|.:.|...:.......:.:.:   |.|.|: .:|.| ....||.||
  Fly   146 IVSDKDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMDRQG-GGGGRGGPR 209

Human   264 A 264
            |
  Fly   210 A 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PABPN1NP_004634.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115
Interaction with SKIP. /evidence=ECO:0000269|PubMed:11371506 2..145 2/6 (33%)
GCG-encoded polyalanine repeat 2..7
Stimulates PAPOLA. /evidence=ECO:0000250 119..147 2/8 (25%)
Necessary for homooligomerization 155..306 33/114 (29%)
RRM_II_PABPN1 173..248 CDD:409966 21/77 (27%)
Interaction with PAPOLA. /evidence=ECO:0000250 286..306
Hrb87FNP_476806.2 RRM1_hnRNPA_like 25..102 CDD:409992 2/6 (33%)
RRM_SF 116..188 CDD:473069 19/71 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.