DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PABPN1 and Rb97D

DIOPT Version :10

Sequence 1:NP_004634.1 Gene:PABPN1 / 8106 HGNCID:8565 Length:306 Species:Homo sapiens
Sequence 2:NP_524520.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster


Alignment Length:169 Identity:35/169 - (20%)
Similarity:64/169 - (37%) Gaps:60/169 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    98 EEEEPGLVEGDPGDGAIEDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMS 162
            :|..|.:::|         ..:||.:|..|...|            .::.|:|            
  Fly    90 QENRPHIIDG---------KTVEAKRALPR
PERE------------SRETNIS------------ 121

Human   163 IEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVR 227
                    .:.::||.:......|.|..:|...|:|..|.:|.||.:|..:|||::||.|.:   
  Fly   122 --------VKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYD--- 175

Human   228 TSLALDESLFRGRQ-IKVI------------PKRTNRPG 253
               |:|:::.:.:. ||.:            .|...:||
  Fly   176 ---AVDKAILKKQHAIKYVHVDVKKSIYNLDKKEKQQPG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PABPN1NP_004634.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115 3/16 (19%)
Interaction with SKIP. /evidence=ECO:0000269|PubMed:11371506 2..145 8/46 (17%)
GCG-encoded polyalanine repeat 2..7
Stimulates PAPOLA. /evidence=ECO:0000250 119..147 5/27 (19%)
Necessary for homooligomerization 155..306 25/112 (22%)
RRM_II_PABPN1 173..248 CDD:409966 22/87 (25%)
Interaction with PAPOLA. /evidence=ECO:0000250 286..306
Rb97DNP_524520.1 RRM2_hnRNPA_like 124..196 CDD:409766 22/77 (29%)
RRM_SF 33..110 CDD:473069 6/28 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.